(data stored in ACNUC7421 zone)

EMBL: CP000529.PE105

CP000529.PE105       Location/Qualifiers
FT   CDS_pept        complement(115233..115898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0107"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; KEGG: rfr:Rfer_3383
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35432"
FT                   /db_xref="GOA:A1VIF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF4"
FT                   /protein_id="ABM35432.1"
FT                   /translation="MHPEPETPILMAEGLSFSHSQPSAPPLFDQLSLVLAPGVTWVCGD
FT                   EGTGKTTLLQLLAGKLPSTGQLRIQGVCLTQEREAYQRQVAWFDPRATALDQQTARQIF
FT                   AGLPQRHPGCDLDALQAHIDGLSLAPHLDKALFMLSTGSRRKVFLAAALAARAPVTLLD
FT                   QPFMALDRPSIDYLLAVLAEAARQPGRAWVVADYEAPGQVALAAVVKLGEPGPISVPN"
     atgcatccag aaccagaaac gcccattttg atggccgaag ggctttcctt cagccattcc        60
     cagccgagtg cgccgccgct gtttgaccag ctgtcgctgg tcctggcgcc cggcgtcacc       120
     tgggtctgcg gcgacgaggg cacaggcaaa accaccctgc tccagttgct ggccggcaag       180
     ctgccctcga cggggcaact gcgcatccag ggtgtgtgcc tgacgcaaga gcgggaagcc       240
     taccaacgcc aggtggcgtg gtttgacccg cgcgctaccg cgctggacca gcaaaccgcc       300
     cggcaaatct ttgccggcct gccccagcgc catcccggtt gcgacctgga cgcgctgcag       360
     gcgcacattg acggcctgag cctggcgccg catctggaca aggcgctgtt catgctgtcc       420
     accggcagcc ggcgcaaggt ttttctggct gccgcgctgg ccgccagggc gccggtcacg       480
     ctgctcgacc agcccttcat ggcgctggac cggccgtcca tcgactatct gctggcggtg       540
     ctggccgagg ccgcccggca gcccggccgg gcctgggtcg tggcagatta cgaagcgccc       600
     ggacaggtgg ctttggcggc ggtggtcaag ctcggggaac cggggccaat ttcagtgcca       660
     aattag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page