(data stored in ACNUC7421 zone)

EMBL: CP000529.PE108

CP000529.PE108       Location/Qualifiers
FT   CDS_pept        116771..117349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0110"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   rme:Rmet_3580 MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35435"
FT                   /db_xref="GOA:A1VIF7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF7"
FT                   /protein_id="ABM35435.1"
FT                   /translation="MPQLLSVQVGLARRTNIGERSILTAYGKQPVAQAVPVLPLGLLGD
FT                   DQADLSVHGGLAKAVYAYPSEHYAYWQAARRGAGVGEIDASLPHGSLGENLTLQGLLET
FT                   EVWAGDVLKFPGCELRVTLPREPCYKFNAAMGFGRASKLMAQTGFCGFYLAVQTSGTLR
FT                   AGESFEVIPGRRGVGIPALFAAKMSKHLR"
     atgccgcaac ttctttcggt tcaggtcggc cttgcccgcc ggacaaacat cggcgagcgc        60
     agcattctga cggcctacgg caagcagccg gtggcgcaag ccgttccggt gctgccgctg       120
     ggcttgctgg gcgacgatca ggctgacctg tcggttcacg gcgggctggc aaaagccgtc       180
     tatgcctacc cttcagagca ttacgcgtac tggcaggccg cccggcgcgg agccggcgtg       240
     ggcgagatcg acgccagcct gccccacggc agcctgggcg aaaacctgac gctgcaaggc       300
     ctgctggaaa ccgaggtctg ggccggcgat gtgctgaaat ttcccggctg cgaactgcgt       360
     gtgacgctgc cacgcgagcc ttgctacaaa ttcaacgccg ccatgggttt tggccgcgct       420
     tccaaactga tggcgcaaac cggcttttgc gggttttacc tggcggtgca aacatcggga       480
     acgctgcgcg ccggcgagtc attcgaggtg attccgggcc ggcgcggcgt cggcattcct       540
     gcgctgttcg ccgccaagat gagcaagcat ctgcgctag                              579
//

If you have problems or comments...

PBIL Back to PBIL home page