(data stored in ACNUC7421 zone)

EMBL: CP000529.PE109

CP000529.PE109       Location/Qualifiers
FT   CDS_pept        complement(117376..118578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0111"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   amino acid-binding ACT domain protein; KEGG: pol:Bpro_0165
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35436"
FT                   /db_xref="GOA:A1VIF8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF8"
FT                   /protein_id="ABM35436.1"
FT                   /translation="MLSLTVIEQAAQRLHGHLLDTPCVESRTLSQLTGAQIYLKFENLQ
FT                   YTASFKERGACNKLAQLTESERQRGVIAMSAGNHAQGVAYHAQRLGIRAVIVMPRFTPG
FT                   VKIERTRGFGAEVVLHGDTLDASRAHAMGLAEREKLVFVHPYDDEAIVAGQGTVGLEML
FT                   HAVPELEVLVIAVGGGGLIAGVATAAKALKPGIEIIGVQTSRFPAMVNAIKGTHHPQGT
FT                   STIADGIAVGTPGVIAQAIIAEKVDDLLLVDEGDIEQAMVMLLEIEKTLVEGAGAAGLA
FT                   ALLKYPARFAGRKVGLVLCGGNIDPLLLAAIIERGMVRAGRLARIRVSARDIPGSLAKI
FT                   TATVADAGANIEEVHHQRAFTMLAAQNVEIELVLQTRGRPHIAQVLQALRTAGFEAEEQ
FT                   H"
     atgctcagcc tgaccgttat cgaacaagcc gcccagcgcc tgcacggaca tttgctggac        60
     acgccctgcg tggaatcgcg cacgctgtcg cagttgaccg gggcgcaaat ttacctgaag       120
     ttcgaaaacc tgcagtacac cgcgtccttc aaggagcgcg gcgcctgcaa caagctggcg       180
     cagctcaccg agtccgagcg ccagcgcggc gtgattgcca tgagcgcggg caaccatgcg       240
     cagggcgtgg cctaccacgc gcagcgcctg ggcattcgcg ccgtcatcgt catgccgcgc       300
     ttcacgccgg gcgtgaagat cgagcgcacc cggggctttg gcgccgaggt ggtgctgcac       360
     ggcgacacgc tcgacgcgtc gcgcgcccat gccatggggc tggccgaacg cgaaaagctg       420
     gtgtttgtgc atccctatga cgatgaagcc atcgtcgccg gccagggcac cgtggggctg       480
     gagatgctgc atgccgtgcc cgaactggaa gtgctggtga ttgccgtggg cggcggcggg       540
     ctgattgccg gcgtggccac ggcggccaag gcgctgaaac ccggcattga aatcatcggc       600
     gtgcagacgt cgcgctttcc agccatggtc aacgccatca agggcacgca ccacccgcag       660
     ggcaccagca cgattgccga cggcattgcc gtgggcacgc ccggcgtgat tgcgcaggct       720
     atcattgccg aaaaagtcga tgacctgctg ctggtcgatg aaggcgacat cgagcaggcc       780
     atggtgatgc tgctggagat tgaaaaaacc ctggtcgaag gcgctggcgc ggccgggctg       840
     gcggcgctgc tcaaataccc ggcgcgcttt gccggccgca aggtcgggct ggtgctgtgc       900
     ggcggcaaca tcgacccgct gctgctggca gcgatcattg agcgcggcat ggtgcgcgcc       960
     gggcggctgg cgcgcatccg ggtcagcgcg cgcgacattc ccggctcgct ggccaaaatc      1020
     accgccacgg tcgccgacgc gggcgccaac atcgaggaag tgcaccacca gcgcgccttc      1080
     accatgctgg cggcgcagaa cgttgagatt gaactggtgc tgcagacgcg cggccgcccg      1140
     catatcgcgc aggtgctgca ggctttgcgc acggcgggat tcgaggctga agagcagcac      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page