(data stored in ACNUC7421 zone)

EMBL: CP000529.PE112

CP000529.PE112       Location/Qualifiers
FT   CDS_pept        complement(122049..123968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0114"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: pol:Bpro_0170 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35439"
FT                   /db_xref="GOA:A1VIG1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG1"
FT                   /protein_id="ABM35439.1"
FT                   /translation="MSGPPLSSLPISSAPSDQPTPLDVLGQVFGYSDFRGPQQAIVEHV
FT                   IAGGDALVLMPTGGGKSLCYQIPAIARQNAGHGVTIVISPLIALMHDQVGALLEAGVSA
FT                   AFLNSTQTFEESSQLEKQLLRNELTLLYAAPERINTPRMKGLLASLHERGLLSLFAIDE
FT                   AHCVSQWGHDFRPEYRSLSLLHETFPDVPRMALTATADALTRQDMIERLKLEDARLFLS
FT                   SFDRPNIRYTIVEKTDATRQLLRFIQAEHHGEAGIVYCQSRKRVEEIAGMLEDAGIKAM
FT                   AYHAGLDAKLRQQRQDRFLREDGCVMVATIAFGMGIDKPDVRFVAHLDMPKNIEGYYQE
FT                   TGRAGRDGLPADAWMVYGLQDVVNQRRMIDTSEVASEEFKAVMRGKLDALLTLAEGTRC
FT                   RRVSLLGYFGEASEPCGNCDNCLTPPAVWDATEAARKMLSCIYRVQQASGISFGAGHIM
FT                   DILRGKPTEKVVQYGHDQLSTFGIGADLAEPQWRGVLRQLIASNLVRVNAEAFNTLQLM
FT                   PDARQVLKGEVSVLLRQQAASAKAERTRRGSKSTVKTSVKGMAEATLNAGALERLGRLK
FT                   AWRTDVAREHNLPPFVIFHDATLRAIAEQAPQDLHALSGISGMGVKKLAAYGAEVLRVC
FT                   AEPG"
     ttgtctggcc cgcccttgtc ctcattgccc atttcttcag ccccttcaga ccagcccacg        60
     ccgctggacg tgcttggcca ggtttttggc tactccgact ttcgcggccc gcagcaagcc       120
     atcgtcgagc atgtgattgc tggcggcgat gcgctggtct tgatgcccac gggcggcggc       180
     aagtcgctgt gctaccagat tccggccatc gcccggcaaa acgccggcca cggcgtgacc       240
     atcgtgatct cgccgctgat cgcgctgatg cacgaccagg tcggcgcgct tctggaagcg       300
     ggcgtgtcgg cggcgttcct caactccacc cagactttcg aggaaagcag ccagctggaa       360
     aagcagctgc tgcgcaatga gctgacgctg ctctacgccg cgcccgagcg catcaacacg       420
     ccgcgcatga agggcctgct ggcgtcgctg cacgagcgcg ggctgctaag cctctttgcc       480
     atcgacgagg cgcattgcgt gagccagtgg ggccacgact tccggcccga gtaccgcagc       540
     ttgagcctgt tgcacgagac cttccccgac gtgccgcgca tggcgctgac cgccacggcc       600
     gacgcgctga cgcgccagga catgatcgag cggctcaagc tcgaagacgc gcgcttgttt       660
     ctaagcagct ttgaccggcc caacatccgc tacaccatcg tcgaaaagac cgacgcgacg       720
     cgccagctgc tgcgcttcat ccaggccgag caccacggcg aagcgggcat cgtctattgc       780
     cagtcgcgca agcgcgtcga ggaaatcgcc ggcatgctcg aagacgcggg catcaaggcc       840
     atggcctacc acgccgggct cgatgccaag ctgcgccagc agcgccagga ccgtttcctg       900
     cgcgaagacg gctgcgtgat ggtggcgacg attgccttcg gcatgggcat cgacaagccc       960
     gacgtgcgct tcgtcgcgca cctggacatg ccaaagaaca tcgaaggcta ctaccaggaa      1020
     accggccgcg ccggacgcga cggcttgccc gctgacgcct ggatggtcta tggcctgcag      1080
     gacgtggtga accagcgccg catgatcgac accagcgaag tcgccagcga ggagttcaag      1140
     gcggtgatgc gcggcaagct ggacgcgctc ttgacgctgg ccgagggcac gcgctgccgc      1200
     cgcgtcagcc tgctgggcta ttttggcgag gccagcgagc cgtgcggcaa ctgcgacaac      1260
     tgcctgaccc cgccggccgt gtgggacgcg accgaggcgg cgcgcaagat gctcagctgc      1320
     atctaccgcg tgcagcaggc cagcggcatc agctttggcg ccgggcacat catggacatc      1380
     ctgcgcggca agccgaccga aaaagtcgtg cagtacggcc atgaccagct cagcaccttc      1440
     ggcatcggcg ccgacctggc cgagccgcag tggcgcggcg tgctgcgcca gctgatcgcc      1500
     agcaacctgg tgcgcgtcaa tgccgaggcc ttcaacacgc tgcaactgat gcccgacgcg      1560
     cgccaggtgc tcaagggcga agtcagcgtg ctgctgcgcc agcaggccgc cagcgccaag      1620
     gccgagcgca cgcggcgcgg cagcaaatcg acggtgaaaa catcggtcaa gggcatggcc      1680
     gaagcgacgc tgaacgccgg cgcgctggaa cgccttggcc gcctgaaagc ctggcgtacc      1740
     gacgtcgccc gggagcacaa cctgccgcca ttcgtgatct tccacgacgc cacgctgcgc      1800
     gcgattgccg agcaggcgcc gcaagacctg cacgcgctga gcggcatcag cggcatgggc      1860
     gtgaagaagc tggcagcgta tggcgccgag gtgctgcggg tgtgcgccga gccggggtaa      1920
//

If you have problems or comments...

PBIL Back to PBIL home page