(data stored in ACNUC7421 zone)

EMBL: CP000529.PE115

CP000529.PE115       Location/Qualifiers
FT   CDS_pept        126045..128864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0117"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: pol:Bpro_0174
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase, DHPS; Methionine synthase, B12-binding module,
FT                   cap domain protein; Vitamin B12 dependent methionine
FT                   synthase, activation region; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35442"
FT                   /db_xref="GOA:A1VIG4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG4"
FT                   /protein_id="ABM35442.1"
FT                   /translation="MSSIQFSHEVPPMKLSGLEPVTIGSDSLFVNIGERTNVTGSKAFA
FT                   RMILNGDYEQALTVARQQVENGAQIIDINMDEAMLDSQAAMVRFLNLIAGEPDIARVPI
FT                   MIDSSKWSVIEAGLRCIQGKGIVNSISMKEGVDAFKHQAKLLKRYGAAAVVMAFDEKGQ
FT                   ADTYERKISICERAYRVLVDEIGFPPEDIIFDPNIFAIATGIDEHNNYAVDFIEATRWI
FT                   KANLPGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGMMGVYDEL
FT                   EPVLRERVEDVVLNRQPVYKPGEAHLTPGERLIEVAETAKSGARDDSKKYEWRALPIRA
FT                   RLSHALVHGNNEFITEDTEEVWQAIKAEGGRPLHVIEGPLMDGMNVVGDLFGQGKMFLP
FT                   QVVKSARVMKQAVAHLLPYIEAEKLLLEAAGGDVKTKGKIIIATVKGDVHDIGKNIVTV
FT                   VLQCNNFEVVNMGVMVPCHEILALAKAEGAHIVGLSGLITPSLEEMQYVAAEMQKDDHF
FT                   RLNKIPLMIGGATTSRVHTAVKISPHYEGPVVYVPDASRSVSVAQSLLSEQAAKYIAEL
FT                   NADYDKVRTQHANKKQTPMWPLAKARANATPIDWTNYTPPVPKFIGRRVFKNFDLAELA
FT                   QFIDWGPFFQTWDLAGPFPAILTDEVVGVEATRVYEDAQKMLKRLIEGRWLTASGVMAL
FT                   LPANSVGDDIEIYTDETRTEVAMTWHGLRQQTEKTAVDGVMRPSRCLADFVAPKVLTPE
FT                   LIAARTRAASAKGQNDLKIADYIGVFAVTAGLGADKKEKAFQADHDDYSSIMFKSLADR
FT                   LAEAFAEALHQRVRRDLWGYAPAESLGHDALIAEQYQGIRPAPGYPACPDHSVKKEMFE
FT                   LLHAGDIGMALTESLAMTPAASVSGFYLSHPQSTYFSVGKIGDDQLQDLARRRGAKAED
FT                   LARLLAPNL"
     atgtcctcca ttcagttttc ccatgaagtc ccgcccatga agctgtccgg cctggagccg        60
     gtcaccatcg gcagcgattc gctgttcgtc aacatcggcg agcgcaccaa cgtcaccggc       120
     tccaaggcct tcgcccgcat gattttgaac ggcgactatg aacaggcgct gacagtggcg       180
     cgccagcagg tcgaaaacgg cgcgcagatc atcgacatca acatggacga ggccatgctc       240
     gacagccagg cggccatggt gcgctttttg aacctgatcg ccggcgagcc cgacattgcg       300
     cgcgttccca tcatgatcga cagctccaag tggagcgtga tcgaggccgg cctgcgctgc       360
     atccagggca agggcatcgt caattcgatt tcgatgaagg agggcgttga cgccttcaag       420
     caccaggcca aactgctcaa gcgctacggc gccgccgccg ttgtcatggc cttcgatgaa       480
     aaaggccagg ccgacaccta cgagcgaaaa atcagcatct gcgagcgcgc ttaccgcgtg       540
     ctggtcgatg agatcggttt tccgcccgaa gacatcattt ttgaccccaa tatcttcgcc       600
     atcgccaccg gcatcgacga gcacaacaac tacgcggtcg atttcatcga ggccacgcgc       660
     tggatcaagg ccaatttgcc gggcgccaag gtgtcgggcg gcgtgtccaa cgtgtcgttc       720
     agctttcgcg gcaacgaccc ggtgcgcgaa gcgattcaca cggtgttttt gtaccacgcg       780
     atccaggccg gcatggacat gggcatcgtc aacgccggca tgatgggcgt ctatgacgag       840
     ctggagccgg tgctgcgcga gcgcgtcgag gacgtggtgc tgaaccgcca gccggtgtac       900
     aagccgggcg aagcgcatct cacgcccggc gaacggctga tcgaagtcgc cgaaacggcc       960
     aaaagcggcg cgcgtgacga cagcaagaag tacgaatggc gcgcgctgcc gatacgcgcg      1020
     cgcctgtcgc atgcgctggt gcatggcaac aacgaattca tcaccgagga caccgaggaa      1080
     gtctggcagg ccatcaaggc cgagggtggc cgcccgctgc acgtcatcga aggcccgctg      1140
     atggatggca tgaacgtcgt cggcgacctg ttcggccagg gcaagatgtt tttgccgcag      1200
     gtggtgaaaa gcgcgcgcgt gatgaagcag gccgtcgccc acctgctgcc ctacatcgag      1260
     gccgagaagc tgctactgga ggcggccggc ggcgatgtca agaccaaggg caagatcatc      1320
     atcgccacgg tcaagggcga tgtgcatgac atcggcaaga acatcgtcac cgtggtcttg      1380
     cagtgcaaca acttcgaggt cgtcaacatg ggcgtgatgg tgccctgcca cgagattctg      1440
     gcgctggcga aagccgaggg cgcgcacatc gtcggcctgt cggggctgat cacgccgagc      1500
     ctggaagaaa tgcagtacgt cgccgccgag atgcagaagg acgaccattt caggctcaac      1560
     aagattccgc tgatgattgg cggcgccacc accagccggg tgcacacggc ggtgaagatt      1620
     tcgccgcact acgaaggccc cgtcgtctat gtgcccgacg cctcgcgcag cgtcagtgtg      1680
     gcgcaaagcc tgctgtccga gcaggcggcc aaatacatcg ccgagctgaa cgccgactac      1740
     gacaaggtgc gcacccagca cgccaacaag aagcagacgc cgatgtggcc gctggccaaa      1800
     gcacgggcca acgccacgcc catcgactgg acgaactaca cgccgcccgt gccgaagttc      1860
     atcggccggc gcgtgttcaa gaattttgat ctggccgaac tggcccagtt catcgactgg      1920
     gggccgttct tccagacctg ggatctggcc gggccgttcc ctgccatcct gaccgacgag      1980
     gtggtcggcg tcgaggcgac gcgcgtctat gaagatgccc agaagatgct caagcgcctg      2040
     atcgaaggcc gctggctcac ggccagcggc gtgatggcgc tgctgccggc caacagcgtc      2100
     ggcgacgaca tcgaaatcta caccgacgag acgcgcaccg aagtggcgat gacctggcat      2160
     ggcctgcgcc agcagaccga aaaaacggcg gtcgatggcg tgatgcgccc cagccgctgc      2220
     ctggccgatt ttgtcgcgcc caaggtatta actcctgaat tgatagctgc tcgcacccgt      2280
     gcagcaagcg caaaaggcca aaatgacttg aaaattgccg attacatcgg ggttttcgcg      2340
     gtcactgccg gcctgggtgc cgacaagaag gaaaaggctt tccaggccga ccatgacgat      2400
     tattcgtcga tcatgttcaa gtcgctcgcc gaccgtctgg ccgaagcctt tgccgaagcc      2460
     ctgcaccagc gcgtgcgccg tgacttgtgg ggctacgcgc cggccgagtc gctgggccat      2520
     gacgccttga tcgccgagca ataccagggc atccgccccg cgcccggcta cccggcctgc      2580
     ccggaccaca gcgtcaagaa ggaaatgttc gagctgctcc acgccggcga catcggcatg      2640
     gcgctgacgg aaagcctggc catgacaccg gcggccagcg tcagcggctt ttacctgagc      2700
     catccgcaaa gcacctattt cagcgtcggc aagattggcg acgaccaact gcaggatctg      2760
     gccaggcggc gcggtgccaa ggccgaagac ctggccaggc tgctggcgcc taatctgtaa      2820
//

If you have problems or comments...

PBIL Back to PBIL home page