(data stored in ACNUC7421 zone)

EMBL: CP000529.PE116

CP000529.PE116       Location/Qualifiers
FT   CDS_pept        129037..130506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35443"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG5"
FT                   /protein_id="ABM35443.1"
FT                   /translation="MLFSWALPRCRTALRCLIGALWLGAAAAFAAPLAYLADRNQNTVS
FT                   VVEMTTYSRLTTISLGAAQASPVELVANEASGKVFVALGTGVAIIDPRTQALAGEIPLA
FT                   LIKAMAVSPDGKKVYALTPGSVSVIDTDSKSVTATLAVDPSAVSLAIDADGETIYVAHT
FT                   GLEPGTENALGAAGITLINGLTPEIENVVSTKDFRPERLAVNPGDDRLYMLGNVGLAAD
FT                   EHAYRMLDPVTSAITRIALVMPPQTPPIPGFTSLAFNQDGSRLYLGGHSFGVTTIPVLE
FT                   VDTAAGTVARVLRVPPGFADEHTALKLATSFANDKFVLIVFVKERLNSAMFEPGRRAVF
FT                   MEVAGGLIVSDFQAPSPGDTDLLTGDILDSAPAPTQGKVPTSTVLQANANPPLRPTLPV
FT                   TFMATVTGNNPTGKVVFRFTARGDHHRMVQKVRVPLNGGVATLALAACNTAWDNAALQK
FT                   IACSPEFKVVAKFRGDPFNARSKSEALHESY"
     atgctgtttt cctgggcgct gccacgctgc aggacggcct tgcgatgcct gatcggcgca        60
     ctctggctgg gagcggcggc agctttcgcc gcacctctgg cctacctggc ggaccgcaac       120
     cagaacactg tgtcggtcgt cgagatgacg acctattcca gactcaccac catttccctg       180
     ggcgcggcgc aggcctctcc ggttgaactg gtggccaatg aggcgtccgg caaggtgttc       240
     gtcgcgctgg gcaccggcgt ggccatcatc gacccgcgca cccaggccct tgccggcgag       300
     ataccgctgg ccctgatcaa ggcgatggcg gtgtcgcccg atggcaagaa ggtgtatgca       360
     ttgacgcccg gctcggtgtc cgtcatcgac accgacagca agtccgtgac ggccacgctg       420
     gccgtggacc cgtcggccgt cagcctggcc atcgacgcgg acggggaaac catttatgtg       480
     gcgcataccg ggcttgagcc gggcaccgaa aatgcccttg gtgccgccgg catcaccctc       540
     atcaacggct tgacccctga aatcgaaaac gtggtcagca ccaaggattt ccggcccgag       600
     cgcctcgccg tgaacccggg cgacgaccgc ctctacatgc tcggaaacgt gggcctggcc       660
     gccgacgagc atgcctaccg gatgcttgac ccggtcactt cagccatcac gcggattgcc       720
     ctcgtcatgc cgccgcagac gccgcccatc cctggattca ccagcctggc cttcaaccag       780
     gatggcagcc gcctgtacct gggcggccac tcgttcggcg tgaccaccat tccggttctg       840
     gaagtcgata ccgccgcagg cacggtggcg cgcgtgctgc gcgtgccgcc gggctttgcc       900
     gacgaacaca cggccctgaa actagcgacc agctttgcca acgacaagtt tgtcctgatc       960
     gtcttcgtga aggagcgctt gaacagcgcc atgttcgagc cggggcggcg cgccgtgttc      1020
     atggaggtgg cgggggggct catcgtgagc gatttccagg ccccgtctcc cggcgacacc      1080
     gacctgctga ccggcgacat cctcgactcg gcccccgcgc ctacccaggg caaggttccc      1140
     accagcaccg tgctgcaagc caatgccaat ccaccgctgc gccccacgtt gccggtcacg      1200
     ttcatggcaa cggtgacggg gaacaatccc accggcaagg tcgtcttcag gttcacggcg      1260
     cgtggcgacc accaccggat ggttcaaaaa gtccgggttc cgctgaacgg aggcgtggcc      1320
     acgctggcgc ttgcggcctg caataccgca tgggacaacg ctgcgttgca gaagattgcc      1380
     tgcagccctg aattcaaggt ggtcgccaaa ttcaggggcg acccattcaa cgccaggagc      1440
     aagtccgaag cccttcacga aagctactga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page