(data stored in ACNUC7421 zone)

EMBL: CP000529.PE117

CP000529.PE117       Location/Qualifiers
FT   CDS_pept        complement(130589..132136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0119"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: pol:Bpro_0181 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35444"
FT                   /db_xref="GOA:A1VIG6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG6"
FT                   /protein_id="ABM35444.1"
FT                   /translation="MSLSLVHSRALLGLQAHPVCVEVHLANGLPSFTLVGLADTEVKEA
FT                   RERVRSAIQNAGLEFPGNKRITVNLAPADLPKDSGRFDLPIALGILAASGQIDARKLAG
FT                   YEFAGELSLGGDVRPVRGALAMSLAIARPAHGGTARKLPRLVLPEGSAQEAALVPDAEI
FT                   YRAHHLLDVVRQFLPGDAVPEVADGWMRVASAAPSRQPAYADLADVKGQAAARRALEIA
FT                   AAGGHSLLMVGSPGSGKSMLAQRFAGLLPAMTTEEALETAAVASLGGRFTLDHWAVRPT
FT                   CAPHHTASAVALVGGGSPPRPGEISLAHRGVLFLDELPEFPRAALEALREPLESGSITI
FT                   SRAASRAEFPARFQLIAAMNPCPCGYLGSSLRACRCSPEQVSRYQGKLSGPLLDRIDLH
FT                   VEVGALAAGELVNTPPGEATETIRSRVVQARERAMSRQGSANQALQGQAIDAQCQLDAT
FT                   AAKFLNTAATRLGWSGRGIHRCLKVARTIADLAGAKTVQLTHVAEAVQYRRALKAAH"
     atgagcctgt ctttagtgca tagccgtgca ttgctgggtc tgcaagcgca cccggtgtgc        60
     gtcgaggtgc atctggccaa cggcctgccc agtttcacgc tggtcggcct ggccgatacc       120
     gaagtcaagg aagcgcgcga gcgggtgcgc tcggccatcc agaatgccgg gctggagttt       180
     ccgggcaaca agcgcatcac ggtgaacctg gcgccggccg acctgcccaa ggattcgggc       240
     cgcttcgacc tgccgattgc gctgggcatc ctggcggcca gcgggcagat tgatgcgcgc       300
     aagctggccg gctatgagtt tgccggcgag ctgtcgctgg gcggcgatgt gcggccggtg       360
     cgcggcgcgc tggccatgag cctggcgatt gcccggccgg cgcatggcgg cacggcgcgc       420
     aagctgcccc ggctggtgct gcccgaaggc agtgcgcagg aagcggcgct ggtgcccgat       480
     gccgagattt accgcgcgca ccacctgctc gacgtggtca ggcagttcct gccgggcgac       540
     gccgtgcccg aggtggccga tggctggatg cgcgtggctt cagccgcgcc gtcccggcag       600
     cccgcttatg cggacctggc cgatgtcaag ggccaggccg ccgcgcgccg ggcactggag       660
     attgcggccg caggcgggca cagcctgttg atggtcggct cgccgggctc gggcaagtcg       720
     atgctggcgc agcgctttgc cggcctgctg ccggccatga cgaccgagga agcgctggaa       780
     accgccgccg tcgcgtcgct gggcgggcgc ttcacgctgg accactgggc cgtgcggccg       840
     acctgcgcgc cgcaccacac ggccagcgcg gtggcgctgg tgggcggcgg ctcgccgccg       900
     cgtccgggtg aaatctcgct ggcgcatcgc ggggtgctgt tcctcgacga gctgccggaa       960
     tttccccgcg ccgcgctgga agccctgcgc gagccgctgg aatcgggcag catcaccatt      1020
     tcacgggccg cgagccgcgc cgagttcccg gcgcgctttc agctcatcgc ggccatgaac      1080
     ccctgcccct gcggctacct gggctccagc ctgcgcgcct gccgctgctc gccggagcag      1140
     gtttcgcgct accagggcaa gctcagcggc cccttgctgg accggatcga cctgcatgtg      1200
     gaagtcggcg cgctggcggc cggcgaactg gtgaacacgc cgccgggcga agccacggaa      1260
     accatccgta gccgtgtcgt gcaggccagg gagcgcgcca tgagccggca gggcagcgcc      1320
     aaccaggcgc tgcaagggca ggcgattgat gcgcaatgcc agctcgatgc cacagcggcc      1380
     aagttcctca ataccgcagc cacccggctg ggctggtcgg gccggggcat tcaccgctgc      1440
     ctgaaagtgg cgcgcaccat tgccgacctg gccggcgcca aaacggtgca actcacgcat      1500
     gtggccgagg ccgtgcagta ccggcgggcg ctgaaggcgg cgcactga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page