(data stored in ACNUC7421 zone)

EMBL: CP000529.PE118

CP000529.PE118       Location/Qualifiers
FT   CDS_pept        132475..132813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0120"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   pol:Bpro_0183 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35445"
FT                   /db_xref="GOA:A1VIG7"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG7"
FT                   /protein_id="ABM35445.1"
FT                   /translation="MKLVTAIIKPFKLDEVREALSGMGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVPDELVDRVIEAIETSARTGKIGDGKVFVYDLEQVVRIRT
FT                   GETGKEAL"
     atgaaactcg tcactgccat catcaaaccg ttcaagttgg acgaggtgcg cgaagcactc        60
     tccggcatgg gtgtacaggg catcaccgtg accgaagtca agggcttcgg ccgccagaaa       120
     ggccataccg agctgtatcg gggcgccgag tacgtggttg acttcctgcc caaggtcaag       180
     atcgaagcgg ccgtgcccga tgagctggtg gaccgggtga tcgaagccat cgagacctct       240
     gcccgcaccg gcaagatcgg cgacggcaag gtttttgtgt acgaccttga gcaggtcgtg       300
     cgtattcgca ccggcgaaac cggcaaggaa gccctctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page