(data stored in ACNUC7421 zone)

EMBL: CP000529.PE119

CP000529.PE119       Location/Qualifiers
FT   CDS_pept        132847..134412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0121"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: pol:Bpro_0184 ammonium
FT                   transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35446"
FT                   /db_xref="GOA:A1VIG8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG8"
FT                   /protein_id="ABM35446.1"
FT                   /translation="MKKLIASLLLGLSLLGTGATAWAQAPAEAPAATASAPAEAKPDAA
FT                   AAPASAPADTAAPAAAAPAPAAEASAAAAPAPVPNKGDTAWMMVSTILVILMVVPGLAL
FT                   FYGGLVRSKNMLSVLMQVMVTFSLIVVLWFIYGYSLAFTEGNAFIGGFDRLFMKGIWDN
FT                   AAGTFANAATFSKGVVIPEIVFAAFQATFAGITCTLIVGAFAERIKFSAVLAFMVIWFT
FT                   FSYAPMAHMVWFWMGPDAYTGKEVVDAMTGKAGYIWQTGALDFAGGTVVHINAAVAGLV
FT                   GAFMVGKRIGYGKEAMAPHSLTLTMVGASLLWVGWFGFNAGSALEANGFAALAFINTLG
FT                   ATAAAVLAWCVGEALLKGKASMLGAASGAVAGLVAITPAAGNVGIAGGLAIGFIAGFAC
FT                   LWGVHGLKKILGADDSLDVFGVHGVGGIVGALLTGVFNSPALGGPGYVADWVTAAMVTT
FT                   ADYSIMSQVWIQAKAVLITIVWSGVVSLVAYKIVDLTIGLRVSEEDEREGLDITAHGET
FT                   AYNR"
     atgaaaaaac tgattgcttc cctgctgctg ggactgagct tgctcggcac gggcgcgacc        60
     gcctgggcgc aggccccggc cgaagcgccc gccgcaaccg cctcggcgcc cgctgaagcc       120
     aagcctgacg ctgccgccgc cccggcttcc gcgcctgccg acacggctgc acccgctgcc       180
     gccgcgccag ccccggccgc cgaagcttcc gccgccgccg cgccagcgcc cgtccccaac       240
     aagggcgaca cggcctggat gatggtctcg accatcctgg tgatcctgat ggtcgtgccc       300
     ggcctggccc tgttctacgg cggcctggtg cgcagcaaga acatgctgtc ggtgctgatg       360
     caggtcatgg tgacgttctc gctgatcgtc gtgctgtggt tcatctacgg ctacagcctg       420
     gccttcaccg agggcaatgc cttcatcggc ggctttgacc ggctgttcat gaaaggcatc       480
     tgggacaacg ccgcaggcac ctttgcgaat gccgcgactt tcagcaaggg cgtcgtgatt       540
     cccgagatcg tgtttgccgc cttccaggcc acctttgccg gcatcacctg caccctgatc       600
     gtcggtgctt tcgccgaacg catcaagttc tccgccgtgc ttgcgttcat ggtcatctgg       660
     ttcaccttca gctacgcccc gatggcgcac atggtctggt tctggatggg tcccgatgcc       720
     tatacaggca aggaagtggt tgacgccatg accggcaagg ccggctacat ctggcaaacc       780
     ggcgcgctgg acttcgccgg cggcaccgtg gttcacatca atgcagccgt ggccggcctg       840
     gtcggcgcct tcatggtcgg caagcgcatc ggttacggca aggaagccat ggcgcctcac       900
     agcctgacgc tgaccatggt gggcgcttcg ctgctgtggg tgggctggtt tggtttcaac       960
     gccggctcgg cactcgaagc caacggtttt gccgcactgg ctttcatcaa caccctgggt      1020
     gcaacggctg cggccgtgct ggcctggtgc gtcggtgaag cattgctcaa gggcaaggcc      1080
     tcgatgctgg gcgccgcttc gggcgctgtc gctggcctgg tggccatcac gccggccgcc      1140
     ggcaacgtcg gcatcgccgg tggcctggcg attggtttca tcgccggctt tgcctgcctc      1200
     tggggcgtgc atggcctgaa gaagatcctg ggcgccgacg actcgctcga cgtgttcggc      1260
     gtgcatggcg tgggcggtat cgtcggcgcc ttgctgaccg gcgtgttcaa ctcgcccgcc      1320
     ctgggcggtc ctggctacgt ggctgactgg gtgaccgcag ccatggtcac cacggccgac      1380
     tattccatca tgtcgcaagt ctggattcag gccaaggccg tcttgatcac catcgtgtgg      1440
     tcgggcgtgg tgtcgctggt ggcctacaag attgttgacc tgaccatcgg cctgcgcgtc      1500
     agcgaagaag acgagcgcga aggtctggac atcaccgcgc atggtgaaac ggcctacaac      1560
     cgttga                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page