(data stored in ACNUC7421 zone)

EMBL: CP000529.PE120

CP000529.PE120       Location/Qualifiers
FT   CDS_pept        134558..135484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0122"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: pol:Bpro_0186 senescence marker protein-30 (SMP-30)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35447"
FT                   /db_xref="GOA:A1VIG9"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG9"
FT                   /protein_id="ABM35447.1"
FT                   /translation="MTWQTAISQPSELGESPFWHPDEQRLYWVDITACQICRADAATGM
FT                   VERWTVPSEPGCIAPARTGGQNSGLVMALRDGIYRARQWGGELALLAPAQHDPATLRFN
FT                   DGKADALGRFWAGTIYEPRGAARAQLFSLDGRGGRAPVLEAKAADATTANGLAWSPDAA
FT                   TLYWADTPRHLVRAWDWDAAGNTLSHERVFRQWPVKPEGWQAGMPGYGGRPDGAAVDSQ
FT                   GNYYVAMYEGARLLKLSPAGELLAEFAVPAQCPTMPCFGGADLKTLYLTTARHGRPAAE
FT                   LQAWPDSGCIFSMRVDVPGLPVNFFRD"
     atgacctggc aaaccgctat ttcccagccc agcgaactgg gcgagtcccc gttctggcac        60
     cctgacgagc aacggctgta ctgggtggac atcaccgcct gccagatttg ccgggccgat       120
     gcagccacag gcatggttga acgctggacc gtgccgtccg agcccggctg catcgcgccg       180
     gcccgcaccg ggggccagaa ctccggcctg gtgatggcct tgcgcgacgg catttaccgc       240
     gcccggcaat ggggcggtga actggccttg ctggcgccgg cgcaacacga cccggccacc       300
     ctgcgcttca acgacggcaa ggccgatgcg ctgggccgct tctgggccgg caccatttac       360
     gagccgcgcg gcgccgcccg ggcgcagctg ttttcgctcg atggccgggg cggccgcgcg       420
     cccgtgcttg aagccaaagc cgccgatgcc accaccgcca acggcctggc ctggtcgccc       480
     gatgcggcca cgctgtactg ggccgatacg ccgcgccacc tggtccgcgc ctgggactgg       540
     gatgccgccg gcaacaccct gagccatgag agggtgttcc ggcaatggcc cgtcaagccc       600
     gaaggctggc aagcgggcat gcccggctat ggcggccggc ccgacggcgc cgctgtcgat       660
     agccaaggca actactacgt cgccatgtac gaaggcgccc ggctgctcaa gctctcgccc       720
     gccggcgagt tgctggccga attcgcggtg cccgcgcagt gcccgaccat gccgtgcttc       780
     ggcggcgctg acctcaaaac gctttacctc acgaccgccc gccatggccg cccggccgcc       840
     gaactgcaag cctggcccga ttcgggctgc atattttcaa tgcgggtcga tgtgccgggg       900
     ttgccggtga attttttcag ggattga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page