(data stored in ACNUC7421 zone)

EMBL: CP000529.PE122

CP000529.PE122       Location/Qualifiers
FT   CDS_pept        136854..137618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0124"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bur:Bcep18194_C7065 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35449"
FT                   /db_xref="GOA:A1VIH1"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH1"
FT                   /protein_id="ABM35449.1"
FT                   /translation="MRRLRHLTGQHRTASINRLLGAVLAFNAGAINAGGFLVVHMYTSH
FT                   MTGFASLLADNLVLGNMRLVLGAIGALLAFTFGAAFTAIQVNWARQHGLRSEYALPLLV
FT                   EALLLLLFGLMGATLNRQTPFAVPLTVLVLSFTMGLQNALVSKVSSSQIRTTHMTGIVT
FT                   DIGIELGKLFYWNRIEGPFESRVRANRIKLRLLCILLGAFVAGGIVGAAGFKYVGFIWV
FT                   VPLALLLLALCLPPLYSDLLRTFRRKLLRQGT"
     atgcgacgtt tgcgccacct gaccggccag caccggacgg cttcgatcaa ccgcctgctc        60
     ggcgccgttc tggccttcaa tgccggcgcc atcaatgccg gcggtttcct ggtggttcac       120
     atgtacacct cgcacatgac cggctttgcc tcgctgctgg ccgacaacct ggtgctgggc       180
     aacatgcgcc tggtgctggg cgccatcggc gccttgctgg cctttacctt tggcgcggcc       240
     tttaccgcca tccaggtgaa ctgggcgcgc cagcacgggc tgcgcagcga atacgcgctg       300
     cccctgctgg tcgaggcgtt gctgctgctg ctctttggcc tgatgggcgc cacgctgaac       360
     cgccagacgc cgtttgccgt gccgctcacg gtgctggtgc tgtccttcac catggggctg       420
     caaaacgcgc tggtcagcaa agtctcatcg tcgcaaatcc gcaccaccca catgaccggc       480
     atcgtgaccg acatcggcat cgagctgggc aagctgtttt actggaaccg catcgaaggc       540
     ccgttcgaat cccgggtgcg cgccaaccgc atcaagctgc gcctgctgtg catcctgctg       600
     ggcgccttcg tggccggcgg catcgttggc gcggccggct tcaagtacgt gggcttcatc       660
     tgggtggttc cgctggcgct gctgctgctc gccctgtgcc tgccgcccct gtattccgac       720
     ctgctgcgca ccttcaggcg caagcttctc cgacaaggca cctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page