(data stored in ACNUC7421 zone)

EMBL: CP000529.PE123

CP000529.PE123       Location/Qualifiers
FT   CDS_pept        137627..138874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0125"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: pol:Bpro_0188 protein of
FT                   unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35450"
FT                   /db_xref="GOA:A1VIH2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH2"
FT                   /protein_id="ABM35450.1"
FT                   /translation="MQTQLAPEFQNTPDGRQAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGETPTRKTQLHLDRCLTCRNCESTCPSGVQYGHLVDIGRKLVDE
FT                   RVPRPVGERAVRWALKEGLPSPLFAPAMKIGQAVRGLLPESLKAKVPPKQPAGQWPTRS
FT                   HARKMLMLEGCVQPAMMPNINSATARVLDAAGIEVVTAAKAGCCGAVKFHLNDQDGGKL
FT                   EMRRNIDAWWPYVEQGVEALVMNASGCGVTVKEYGYILKDDAAYAEKAARISALTRDLS
FT                   ELLPVIAESLQASRPDLAGKIAAGAPRLAFHPPCTLQHGQQLRGGVEQHLGALGFDIKV
FT                   SGNEAHLCCGSAGTYSVLNPEIAYQLRDRKLANLDAMAPEVIVSANIGCITHLQSGTTT
FT                   PVRHWVEVLNEALLNQ"
     atgcaaaccc aactcgcccc cgaattccag aacacgcccg atggccgcca ggccgaagcc        60
     attttgcgca aatgcgtgca ctgcggtttc tgcaccgcca cctgcccgac ctaccagctg       120
     ctcggcgacg agctggacgg cccgcgcggc cgcatctacc tgatcaagca ggtgctcgaa       180
     ggcgaaacgc cgacgcgcaa gacccagttg cacctggacc gctgcctgac ctgccgcaac       240
     tgcgaatcca cctgccccag cggcgtgcag tacggccacc tggtcgatat cggccgcaag       300
     ctggtcgatg aacgcgtgcc gcgcccggtg ggcgagcgcg ccgtgcgctg ggcgctcaag       360
     gaaggcctgc cgtcgccgct gttcgccccc gccatgaaga tcggccaggc ggtgcgcggc       420
     ctgctgcccg agtcgcttaa ggccaaggtg ccgcccaaac agccggccgg ccagtggccc       480
     acgcgcagcc atgcgcgcaa gatgctgatg ctggagggct gcgtgcagcc ggccatgatg       540
     cccaacatca attcggccac cgctcgcgtg ctggacgccg ccggcatcga ggtcgtgacg       600
     gcggccaagg ccggctgctg cggcgcggtg aagttccacc tgaacgacca ggacggcggc       660
     aagctggaaa tgcgccgcaa catcgacgcc tggtggccgt atgtggagca gggcgttgaa       720
     gcgctggtga tgaacgcctc gggctgcggc gtcaccgtca aggaatacgg ctacatcctg       780
     aaagacgatg cggcctatgc cgaaaaagcc gcccgcatca gcgcgctgac ccgcgacctg       840
     agcgagttgc tgccggttat cgccgaatcg ctgcaagcca gccggcccga cctggccgga       900
     aagattgccg ccggcgcccc caggctggcg tttcacccgc cgtgcacgct gcagcacggc       960
     cagcagctgc gcggcggcgt cgagcagcat ctgggcgcat tgggtttcga catcaaggtc      1020
     tccggcaatg aggcgcacct gtgctgcggc tcggcgggca cctactcggt gctgaacccc      1080
     gagatcgcct accagttgcg cgaccgcaag ctggccaacc tggacgccat ggcgcccgag      1140
     gtgattgtct ctgccaacat cggctgcatt acccacctgc aaagcggcac cacgacaccg      1200
     gtgcggcact gggtcgaggt gctcaatgaa gcgctattga atcaatag                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page