(data stored in ACNUC7421 zone)

EMBL: CP000529.PE127

CP000529.PE127       Location/Qualifiers
FT   CDS_pept        complement(141352..142260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0129"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pol:Bpro_0191 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35454"
FT                   /db_xref="GOA:A1VIH6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH6"
FT                   /protein_id="ABM35454.1"
FT                   /translation="MAGLHPARAAHGRTAALAVGALVLNALVWGVSWWPFRQLQDHGLH
FT                   PLWATALMYLLIVAGLLAVQFKAWRGFAAHPQLWLLGLAAGLTNIGFNWAVTVGDVVRV
FT                   VLLFYLMPAWSVLVAWLLLGEKPTAASLFRLLLAMSGVLIVLKAPGSAWPLPQGAADWL
FT                   AIAGGFSFAVTNCLLRKFADAPGNTCMLAMFGGSGLMATLAALLGMSLQVVPGPALQAA
FT                   GIPVLLGLSLAFMASNAALQYGAARLAAGATAIVMLTEILFASGSAAALGAAQFTPRIL
FT                   LGGSLIVLAAVLAATAPSAKE"
     atggctggcc ttcatccggc ccgcgcggca cacgggcgaa cggctgcgct ggcggtcggc        60
     gcgctggtct tgaatgcgct ggtctggggc gtttcctggt ggccgtttcg ccagctgcag       120
     gaccatggcc tgcatccgct gtgggccacg gcgctgatgt acctgctgat cgtggccggg       180
     ctgctggccg tgcagttcaa ggcctggcgc ggctttgcgg cgcatccgca gctgtggctg       240
     ctgggcctgg cggcgggcct gacgaatatc ggcttcaact gggccgtcac cgtgggcgac       300
     gtggtgcggg tggtgctgct gttttacctg atgccggcct ggtcggtgct ggtggcgtgg       360
     ctgctgctgg gtgaaaaacc gaccgccgca tcgctgtttc ggctgctgct ggccatgagc       420
     ggggtgctga tcgtgctgaa ggcgcctggc tctgcgtggc cgctgccgca gggcgccgcc       480
     gactggctgg ccattgcggg cggcttcagt tttgcggtca ccaattgcct gctgcgcaaa       540
     ttcgccgatg cgcccggcaa cacctgcatg ctggccatgt ttggcggcag cggcctgatg       600
     gcgacgctgg ccgcgctgct cggcatgtcg ctgcaggtgg tgcccggccc ggcgctgcag       660
     gcggccggca ttccggtgct gctgggactg agcctggcct tcatggccag caacgcggcc       720
     ctgcagtacg gcgcggcacg cctggcggcc ggcgcgacgg cgattgtgat gctgaccgaa       780
     atcctgtttg ccagcgggtc cgccgccgcg ctgggggccg cccagttcac gccgcgcatc       840
     ctgctgggcg gcagcctgat cgtgctggcg gcggtgcttg cagccacggc gccttcggcc       900
     aaagaataa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page