(data stored in ACNUC7421 zone)

EMBL: CP000529.PE129

CP000529.PE129       Location/Qualifiers
FT   CDS_pept        143732..144829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0131"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pol:Bpro_0193 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35456"
FT                   /db_xref="GOA:A1VIH8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIH8"
FT                   /protein_id="ABM35456.1"
FT                   /translation="MPRPILATIHLAALSHNLARVRTAAPDAKVWAVVKANAYGHGIER
FT                   VFDALRSADGFALLDLDEARRLRALDWRGPILLLEGCFEARDLELCSRLGLWHTIHCQE
FT                   QIDMLAAHKTQLPHRVFLKMNTGMNRLGFTPERFRAAWIRLNALPQVDEISLMQHFPDA
FT                   DGPKGITAQLQAFDAVTHDLPGERTLSNSAAILRHTGALAGRSDWVRPGIVLYGSAPDF
FT                   PEHSASDWELQPTMTLSSRIIGLQTLAAGDTVGYGSSFVAEGPMRIGVVACGYADGYPR
FT                   HCPTGTPVLVNGVRTRMVGRVSMDMITVDLTPVPRAGMGSEVTLWGRASKGGAMLPIDE
FT                   VARAAGTVGYELMCAVAPRVPVAVD"
     atgccacgtc ccattcttgc caccatccac cttgccgccc tcagccacaa cctggcgcgc        60
     gtgcgcaccg ccgcgcctga cgccaaggtc tgggccgtcg tcaaggccaa cgcctacggc       120
     cacggcatcg agcgcgtttt cgatgcgctg cgtagcgccg acggctttgc gctgctcgac       180
     ctggacgagg ccaggcgcct gcgcgcgctc gactggcgcg gcccgatcct gctgctcgaa       240
     ggctgcttcg aggcgcgcga cctggaactg tgctcgcgcc tgggcctgtg gcacacgatt       300
     cattgccagg agcagatcga catgctggcc gcgcacaaga cgcagctgcc gcaccgcgtg       360
     ttcctgaaga tgaacaccgg catgaaccgc ctgggcttca cgcccgagcg ctttcgcgcc       420
     gcctggattc gcctcaatgc cctgccgcag gtcgatgaaa tctcgctgat gcagcatttt       480
     cccgatgccg acggccccaa gggcatcacc gcgcagctcc aggctttcga cgccgtgacg       540
     catgatttgc ccggcgagcg cacgctcagc aacagcgccg ccatcctgcg ccacaccggc       600
     gcgctggccg ggcgctcgga ctgggtgcgg cccggcatcg tgctctacgg cagcgcgccc       660
     gactttcccg agcacagcgc cagcgactgg gagttgcagc cgacgatgac gctgtcatcc       720
     cgaatcatcg gcctgcagac cctggcggct ggcgacacgg tgggctacgg ctccagcttt       780
     gtcgccgaag ggccaatgcg catcggcgtc gtggcctgcg gctacgccga cggctacccg       840
     cgccactgcc ccaccggcac gccggtgctg gtgaacggcg tgcgcacgcg catggtcggg       900
     cgcgtcagca tggacatgat caccgtggac ctcacgcccg tgcccagggc cggcatgggc       960
     agcgaggtca cgctctgggg ccgcgcgtca aaaggcggcg ccatgctgcc catcgacgag      1020
     gtggcgcggg ccgccggcac ggtgggctac gagctgatgt gcgcggtggc gccgcgcgtg      1080
     ccggtggcgg tcgattga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page