(data stored in ACNUC7421 zone)

EMBL: CP000529.PE131

CP000529.PE131       Location/Qualifiers
FT   CDS_pept        145719..146114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0133"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: neu:NE2224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35458"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII0"
FT                   /protein_id="ABM35458.1"
FT                   /translation="MNRKALLDMLCSRVPDLLAIYAFGSRMQGTAGPQSDLDLAVLVAG
FT                   YADPLALWELSGDLADLAGCPVDLLDLRAASTVMQHQIITTGQRWWVWDAQAALYEAAI
FT                   LSEKTALDTARAGLLDDIQKRGRVYGR"
     atgaaccgaa aagccctcct tgacatgctg tgcagccgcg tgccggacct gctggcgatc        60
     tacgcctttg gcagccgcat gcaaggcacg gcggggccgc aaagcgacct cgacctggct       120
     gtcctggtgg ctggatatgc cgatccgctg gccttgtggg aactgtccgg cgacctggct       180
     gacctggccg gctgcccggt cgatttactg gacctgcgcg cggcctcgac cgtgatgcaa       240
     caccagatca tcaccaccgg ccagcgctgg tgggtctggg atgcgcaggc cgccctgtac       300
     gaggcggcga ttctgagcga aaagaccgcg ctcgataccg cgcgtgcggg cctgctcgac       360
     gacattcaaa aaaggggacg cgtttatggc cgatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page