(data stored in ACNUC7421 zone)

EMBL: CP000529.PE138

CP000529.PE138       Location/Qualifiers
FT   CDS_pept        151598..152002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35465"
FT                   /db_xref="GOA:A1VII7"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII7"
FT                   /protein_id="ABM35465.1"
FT                   /translation="MNFQKILIPVAGVAAVALAYRQYGWAGVAAVATGLVMWMLLHFTR
FT                   MMTVLKRAANRPIGYVGSAVMLNAKLKPGMTLMHVIAMTRALGQLQSEKDAQPEVFRWT
FT                   DGTDSHVTCTFVGGKLAHHELFRPEEPAPQ"
     atgaactttc agaaaatcct tattcctgtc gccggcgtgg cggcggtggc actggcttac        60
     cggcagtacg gctgggctgg cgtggcggcc gtggccaccg gcctggtgat gtggatgctg       120
     ctgcatttca cccgcatgat gacggtcctc aagcgcgccg ccaaccggcc catcggttat       180
     gtcggcagcg ccgtcatgct caacgccaag ctcaagcccg gcatgacgct gatgcatgtg       240
     atcgccatga cccgcgcgct gggccagctc cagtccgaaa aagacgccca gcccgaggtg       300
     ttccgctgga ccgacggcac cgattcgcac gtcacctgca cctttgtcgg cggcaagctg       360
     gcgcatcacg agctgttccg gcctgaagag cctgcgccgc agtga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page