(data stored in ACNUC7421 zone)

EMBL: CP000529.PE139

CP000529.PE139       Location/Qualifiers
FT   CDS_pept        complement(152045..152521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0141"
FT                   /product="putative transposase of insertion sequence
FT                   ISRm10-1"
FT                   /note="KEGG: sme:SMb21046 putative transposase of insertion
FT                   sequence ISRm10-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35466"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII8"
FT                   /protein_id="ABM35466.1"
FT                   /translation="MAPTRGRSPRGQRCRGFAPAGHWRTTTFVCALSTQGLRAPLVLDG
FT                   PLNGPAFRAWVEQFLVPELRPSDIVVMDNLSAHKVAGIQAAIEQAGATVKYLPPYSPDF
FT                   NPIEQVFAKLKAMLRKTQARTVDALWSAIGQLLDRFGSAECERYVRHCGYCGSG"
     atggccccga cgcggggccg ctcgccgcgg ggccagcgct gccggggctt tgcgcccgcc        60
     ggccactggc gcaccaccac gtttgtctgc gcgctgagca cccaggggct tcgggcgccc       120
     ctggtacttg acggccccct caacgggcct gcctttcgcg cctgggtcga gcagtttctc       180
     gtgcccgaac tgcggcccag cgacatcgtg gtaatggaca acctcagcgc ccataaagtc       240
     gccggcatcc aggcggccat cgagcaagcc ggggcgacgg tgaagtacct gccgccctac       300
     agcccggact tcaaccccat cgagcaggtc tttgccaagc tcaaggcgat gctgcgaaag       360
     acccaggcca gaaccgtcga tgccttgtgg agcgccattg gccaattgct cgaccggttt       420
     ggcagcgccg agtgcgagcg ctacgttcgc cactgtggct attgcgggtc agggtga          477
//

If you have problems or comments...

PBIL Back to PBIL home page