(data stored in ACNUC7421 zone)

EMBL: CP000529.PE141

CP000529.PE141       Location/Qualifiers
FT   CDS_pept        complement(153075..153602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0143"
FT                   /product="Spore coat U domain protein"
FT                   /note="PFAM: Spore coat U domain protein; KEGG:
FT                   bxe:Bxe_B0341 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35468"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ0"
FT                   /protein_id="ABM35468.1"
FT                   /translation="MRHPSSRPPARKIPVLPSALFLLLATAGPAQAGSCTVGSSGLAFG
FT                   AYQPLTFAGKLTSSAVTSNASISVVCTGIASGGAYSIALGPSTTGSGDRISTRYLGNSN
FT                   GGDDMSFNIYTSASYSTVWGNGTTGGLVGGSIPVGDSNQSQPVYGRIAASQNTLRAGSY
FT                   SGSLTMTLTYNP"
     atgcgacatc cctcgtcaag gcctccagcc cgcaagatac cggtcctgcc gtcagcgctg        60
     tttttgctgc ttgcgaccgc cgggccagcc caggcgggca gttgcaccgt gggttcgagc       120
     gggctggctt ttggcgccta ccagcccctg acgtttgcgg gcaagctcac ttcatcggcc       180
     gtgaccagca acgccagcat ttcggtggtc tgcaccggca ttgccagcgg cggcgcctac       240
     agcattgccc tggggccgag caccaccggc agcggcgacc gcatcagcac gcgctacctg       300
     ggcaacagca atggcggcga cgacatgagc ttcaacatct acaccagcgc gagttattcg       360
     accgtctggg gtaacggcac gacgggcggc cttgtgggcg ggagcattcc tgttggcgac       420
     agcaaccagt cgcaacccgt gtacggcagg attgcggcga gccagaacac gctcagggcc       480
     ggcagctatt caggctcgct gaccatgacg ctgacctaca acccctag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page