(data stored in ACNUC7421 zone)

EMBL: CP000529.PE144

CP000529.PE144       Location/Qualifiers
FT   CDS_pept        complement(157017..157703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0146"
FT                   /product="Spore coat U domain protein"
FT                   /note="PFAM: Spore coat U domain protein; KEGG:
FT                   ade:Adeh_3602 spore coat U"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35471"
FT                   /db_xref="GOA:A1VIJ3"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ3"
FT                   /protein_id="ABM35471.1"
FT                   /translation="MFSSRQCPDAQTLAGNQASSQCPFRVLWLMAVLGGAILPRVFFDK
FT                   RFGMNTTMNKLALAIGALVMAGGAMAADDNANLAVSATVLTNCAIGPGTLAFPANLQLG
FT                   VTKGLGTKAANPANADSDSGTSISVTCTNGSSAAITAGAGANTAGVVATTRALKSGSNY
FT                   IDYELYTDTNRTTVLDGTNSISYTGTGLTEIDKTTIFGRILGADIATAKAGAYADTVAM
FT                   TITYTP"
     ttgttttcct cccgccaatg cccagacgct cagacgttgg cgggaaacca ggcaagttcg        60
     cagtgcccat ttcgggtgct gtggttgatg gcagtgttgg gtggggcgat tttgccccgt       120
     gtattttttg acaagaggtt cggtatgaac acgacaatga acaagctggc actggcaatt       180
     ggtgcgttgg tgatggcggg tggggcgatg gcggctgatg acaatgccaa cttggcggtg       240
     agcgcgacgg ttctgaccaa ttgcgcgatc ggtccgggta ctttggcctt ccccgcaaac       300
     ctgcagcttg gcgtaaccaa gggccttggc acaaaggctg cgaatccagc aaatgctgat       360
     tctgattctg gtacatctat cagtgttact tgcaccaatg ggtccagtgc cgccattaca       420
     gctggcgcgg gcgcgaatac cgctggtgta gtcgctacga cgcgggcctt gaaatcgggt       480
     tctaactata ttgattacga gttgtatacg gacacaaacc gcacaactgt tttggatggc       540
     acaaactcga tttcatacac tggtacgggt ctgactgaaa tagacaagac caccattttt       600
     ggtcgtattc tcggtgccga tattgcaacg gcgaaagctg gtgcctatgc cgataccgtt       660
     gcaatgacga ttacctatac accatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page