(data stored in ACNUC7421 zone)

EMBL: CP000529.PE146

CP000529.PE146       Location/Qualifiers
FT   CDS_pept        159071..159280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35473"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ5"
FT                   /protein_id="ABM35473.1"
FT                   /translation="MSKSSTIELLASDLNHQGCVTCPSPKADMKVWNSHPKVYLDVART
FT                   GEAKCPYCGEIYKLKAGEHFGSGH"
     atgagcaaat catccaccat cgaactgctg gccagcgacc tgaaccacca gggctgcgtg        60
     acctgcccca gccccaaggc cgacatgaag gtctggaaca gccaccccaa ggtctatctg       120
     gacgtggcgc gcaccggcga agccaagtgc ccctactgcg gcgagatata caagctcaag       180
     gccggcgagc actttggcag tggacattag                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page