(data stored in ACNUC7421 zone)

EMBL: CP000529.PE148

CP000529.PE148       Location/Qualifiers
FT   CDS_pept        complement(160648..161892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0150"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: pol:Bpro_0207 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35475"
FT                   /db_xref="GOA:A1VIJ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ7"
FT                   /protein_id="ABM35475.1"
FT                   /translation="MSKQIWARFTSHLYVRIWLAVVATVMVLTFLVGAAWRLSADPPQL
FT                   PIREVLVHNAAGEVIGKGQTKPDRQRGDDIEFDVVTTDGQTLNLLLPRPQRPPGSPWNR
FT                   PPFGFGWMLGLVGLAVALGAYPVMRRLTLRLEALQRGVERWGAGDLSARINTEGRDEVA
FT                   FLARRFNHAAERIETLMESHKSLLANASHELRSPLARIRMGLELMGVDKSSPQRMEISR
FT                   SIGELDQLIDEILLASRLDTKQADAEPFETLDLTGLAAEECARVNAELQAELQTGPDAD
FT                   HSLTLQGSPRLLRRLIRNLLENARRYSHGDISLELAQSGTGSGQRAIVKVHDRGPGVPA
FT                   GQRERIFEPFYRLPGASEREGGVGLGLALVKSISERHGGSVRCEERPGGGASFIVELPM
FT                   DRPGPAAARDTGSFN"
     gtgagcaagc agatctgggc ccggtttacc tcgcacctgt atgtgcggat ctggctggct        60
     gtggtggcga ccgtcatggt gctgaccttc ctggtgggcg ccgcctggcg gctgagcgcc       120
     gacccgccac agctgcccat ccgcgaagtg ctggtgcaca acgccgccgg cgaagtcatc       180
     ggcaaggggc agaccaagcc tgatcgccag cgcggcgacg acatcgaatt tgacgtggtc       240
     accaccgacg gccagaccct gaacctgctg ctgccccggc cgcagcgccc gccgggcagc       300
     ccctggaacc ggccgccgtt cggctttggc tggatgctgg gcctggtcgg cctggccgtg       360
     gcgctgggcg cctacccggt catgcggcgc ctgacgcttc ggcttgaagc cctgcagcgc       420
     ggcgtggagc gctggggcgc gggcgacctg tcggcacgca tcaataccga ggggcgcgac       480
     gaggtggctt tcctggcgcg gcgcttcaac cacgccgccg agcgcatcga gacgctgatg       540
     gagtcgcaca agtcgctgct ggccaatgcc tcgcacgagc tgcgctcgcc gctggcgcgc       600
     atccgcatgg ggctcgaact gatgggcgtg gacaagtcgt caccgcagcg catggaaatt       660
     tcccgcagca tcggcgagct agaccagctg atcgacgaga tcttgctggc cagccggctc       720
     gacaccaagc aggccgatgc cgagcctttc gaaacgctgg acctgaccgg actggccgcc       780
     gaggaatgcg cgcgcgtcaa tgccgagctg caggccgaac tgcaaaccgg gccggacgcg       840
     gaccacagcc tgacgctgca gggctcgccc cggctgctgc gccggctgat ccgcaacctg       900
     cttgaaaacg cccggcgcta cagccacggc gacatcagcc ttgaactcgc ccagagcggc       960
     acgggcagcg ggcagcgggc catcgtcaag gtgcatgacc gggggccggg cgtgccggcc      1020
     gggcagcgag agcgtatttt cgagcccttt taccggcttc ccggcgccag cgagcgcgaa      1080
     ggcggcgtgg gcctggggct ggcgctggtc aagtcgatca gcgaacgcca tggcggcagc      1140
     gtgcgttgcg aggaacggcc tggcggcggc gcgtcattca ttgtcgaact gccgatggac      1200
     cggcccggcc cggcggcggc ccgtgatacc ggaagtttca actaa                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page