(data stored in ACNUC7421 zone)

EMBL: CP000529.PE153

CP000529.PE153       Location/Qualifiers
FT   CDS_pept        complement(165477..166067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_3538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35480"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK2"
FT                   /protein_id="ABM35480.1"
FT                   /translation="MNKINSILALSASMCMLMNANGQALTSGATSAPVASSSAGNQDFY
FT                   QGITFNSPGETHQYIESGGTQTIKNVPSVAGPNLTTSNDTCMGSSSGSMNGPGFGVSIG
FT                   STWSDANCKLLKNSRELWNMGMKAAAMALMCTDAANRDALEMTGFECPQTSRNKKIAQQ
FT                   ASAVNPPSSGDQEHITDPYIRARMGLAALQAKN"
     atgaataaaa ttaattctat attggcatta tcggcgtcca tgtgcatgtt gatgaacgcc        60
     aatggccagg ccttgacatc cggcgccact tcagccccgg ttgcatcttc aagtgcaggc       120
     aatcaggatt tctatcaagg catcaccttc aacagcccgg gggagacgca ccagtatatt       180
     gaatcaggtg gcacgcaaac catcaagaat gttccctccg tggcggggcc gaatttgaca       240
     acatcgaacg atacctgcat gggctcatcg tccggctcca tgaatgggcc tggatttgga       300
     gtatccatag gcagcacctg gtctgatgcg aattgcaagc tgctgaaaaa cagccgtgaa       360
     ctatggaaca tgggcatgaa ggcggctgcg atggccctta tgtgcaccga tgccgcgaat       420
     cgggatgcgc ttgaaatgac gggctttgaa tgccctcaga catcgagaaa taaaaagatc       480
     gcccaacagg cctctgctgt aaatccacct tcatcaggtg accaggaaca tattaccgac       540
     ccctatattc gtgcacgaat gggactcgcc gcgctgcaag ccaaaaatta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page