(data stored in ACNUC7421 zone)

EMBL: CP000529.PE156

CP000529.PE156       Location/Qualifiers
FT   CDS_pept        166913..167155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35483"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK5"
FT                   /protein_id="ABM35483.1"
FT                   /translation="MFQSAGKTPVFDCDAIRFPVVQKLINIFLFMNKQEFLLCAVFFFS
FT                   LHGSNFLVHITVADAAVCAGLLRSIIIYCADSTTP"
     ttgttccagt cggctggaaa aactcctgtt tttgactgtg acgcaatccg ttttcctgtc        60
     gtgcaaaaat taattaacat cttcctgttt atgaataaac aggaattttt actgtgcgct       120
     gtatttttct tttcacttca tgggtcaaat tttttagttc acataacagt tgctgatgct       180
     gctgtttgtg ctgggctgtt gaggtcaata ataatttatt gcgctgattc aacaaccccc       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page