(data stored in ACNUC7421 zone)

EMBL: CP000529.PE160

CP000529.PE160       Location/Qualifiers
FT   CDS_pept        complement(170874..171479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0162"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_3964
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35487"
FT                   /db_xref="GOA:A1VIK9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK9"
FT                   /protein_id="ABM35487.1"
FT                   /translation="MSNEHTDVKQHILDTGRSIILGKGFSAVGLNEILSTAQVPKGSFY
FT                   HYFKSKEAFGEALVDGYVADYLAQVDRLLQDDGAPAAERLMRYWRSWMTPADSQSAECN
FT                   CLVVKLSGEVSDMSEAMRAALLRGTNLIIERLGNCIAQGLADGSLTGTLEAQHTALTLY
FT                   ELWLGAALLTKVRRERSALDAAMAATCSLLKLPQPVSA"
     atgagcaatg aacacaccga tgtcaaacag cacatcctcg acaccggacg cagcatcatc        60
     ctgggcaagg gcttttcggc cgtgggcctg aacgaaatcc tgtccaccgc ccaggtgccc       120
     aagggctcgt tctaccacta cttcaagtcc aaggaagcgt ttggcgaggc gctggtggac       180
     ggctatgtgg ccgactacct ggcgcaggtg gaccggctgc tccaggacga cggcgccccg       240
     gccgcagagc gtttgatgcg ctactggcgc agctggatga cgcccgccga cagccagagc       300
     gccgaatgca actgcctggt cgtgaagctc agcggcgagg tctcggacat gtccgaggcg       360
     atgcgcgcgg ccttgctgcg cggcaccaat ttgatcatcg agcggctggg caactgcatt       420
     gcgcagggcc tggccgacgg ctcgctgacc ggcaccctgg aggcgcagca caccgcgctg       480
     acgctgtacg agttgtggct gggcgcggcc ctgctgacca aggtcaggcg cgagcgcagc       540
     gcgctggatg cggccatggc ggcgacctgc agcctgctga agctgccgca gccggtgagc       600
     gcctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page