(data stored in ACNUC7421 zone)

EMBL: CP000529.PE161

CP000529.PE161       Location/Qualifiers
FT   CDS_pept        171564..172418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0163"
FT                   /product="protein of unknown function RIO1"
FT                   /note="PFAM: protein of unknown function RIO1; KEGG:
FT                   pol:Bpro_3868 protein of unknown function RIO1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35488"
FT                   /db_xref="GOA:A1VIL0"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL0"
FT                   /protein_id="ABM35488.1"
FT                   /translation="MAGMKAPPRLQSLVEEGLIDTVVRQLMSGKEAMVYVVRCGDETRC
FT                   AKIYKEADQRSFRQAVDYTENRKVKNTRQARAMAKGTKFGRQASEAAWQSAEVDALYRL
FT                   ADAGVRVPQPHNFCDGVLLMELVTDAHGDAAPRLNDVDFTPEQARRHHATLITEVIRML
FT                   CAGIVHGDLSEFNILLAEDGPVIIDLPQAVDAAGNNHASRMLLRDVANLRNFFGRFAPD
FT                   LLTIDYGNEMWDLYQRGVLYPETVLTGHFRRKTGPVDVGGVLREIDDASAEEAARRMRM
FT                   AQS"
     atggcgggca tgaaagcacc tccaagactg caatccctcg ttgaagaggg cctgatcgac        60
     accgtggttc gccagctgat gagcggcaag gaagcgatgg tgtacgtcgt gcgctgtggc       120
     gacgaaaccc gctgcgccaa gatctacaag gaagccgacc agcgcagctt tcgccaggcg       180
     gtcgattaca ccgaaaaccg caaggtcaag aacacccggc aggcccgggc catggccaag       240
     ggcaccaaat tcggccggca ggccagcgaa gccgcctggc agagcgccga ggtcgatgcg       300
     ctctaccggc tggccgacgc cggggtgcgc gtgccccagc cacacaattt ctgcgacggc       360
     gtgctgctga tggaactggt gaccgacgcg cacggcgacg cggccccgcg cctgaacgac       420
     gtcgatttca cgcccgagca ggcgcgccgg caccatgcga cgctgatcac cgaggtaatc       480
     cgcatgctgt gcgccggcat cgtgcacggc gacctgtcgg agttcaacat cctgctggcc       540
     gaagacggcc cggtcatcat cgacctgccg caggcggtgg atgctgccgg caacaaccac       600
     gccagccgca tgctgctgcg cgacgtggcc aacctgcgca acttcttcgg tcgtttcgcg       660
     cccgacctct tgaccatcga ctacggcaac gagatgtggg acttgtacca gcgcggcgtg       720
     ctgtaccccg agacggtgct gaccggccat ttcaggcgca agaccggccc ggtcgatgtc       780
     ggcggcgtgc tgcgcgagat tgacgacgcc agcgccgagg aggccgcgcg ccgcatgcgc       840
     atggcgcagt cgtag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page