(data stored in ACNUC7421 zone)

EMBL: CP000529.PE164

CP000529.PE164       Location/Qualifiers
FT   CDS_pept        176615..178423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0166"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: gsu:GSU0255 sensory box histidine kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region,
FT                   ATPase domain protein domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35491"
FT                   /db_xref="GOA:A1VIL3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL3"
FT                   /protein_id="ABM35491.1"
FT                   /translation="MLFQQLYWIAMPQNLKAILKTDGSRFALGTGVLYAVLGLLWIIAS
FT                   DAAISSISTDPAWLVTAQRYKGFFYVGVTSVGLIFLVNAGYRRLWNALSRAEATELQIG
FT                   DLFLQHPKPMWVYDRDTLEFIAVNDAATRYYGYSREAMLAMNLADICPEEDISRLHALM
FT                   HSPQDRHRDIGVVRHCKRSGEVVFVHLTAHAVEFMQRKAEMVMAIDVTADILSKHALER
FT                   QEAQFRQLHQSLASILWIASADGRTMLYVSPALERVYGFAPEAMQANPDLWLQVVHPDD
FT                   AHIAKASSVELMTEGEASCEYRIRATSGEIKWVSDRKRLIVDAEGLVTMMGGILEDITA
FT                   AKEHEALRARTHVELERLVTERTAELVRVNAELDAFARTIAHDLKAPLVSVIGFSQLLQ
FT                   NRHADTLKEDGVRLIARIGRSARQMASLVNDLLALSRVSKTVLVIEDIDLVPLAHEIIE
FT                   ELREQEPHRQVRFESPASLQVRADPGLVRPLLTNLLGNAWKFTGKRDDACVQLLLAGAA
FT                   PEATFCVRDNGVGFDASSSELLFKPFQRFHTLSEFSGTGIGLTTCERIVARHHGRIWLE
FT                   STVGEGTSVFVTLAPPAPDLPHLAPA"
     atgttgtttc aacaactcta ctggattgca atgcctcaaa atttgaaagc aatcctgaaa        60
     acggatggct cacgattcgc actgggaacc ggcgtgcttt acgcggtgct tggattgttg       120
     tggatcattg cctcggatgc ggctatttcg tccatttcca ccgaccccgc atggctggta       180
     acggcacagc gctacaaggg atttttctat gttggggtga cctccgtggg gctgattttc       240
     ctggtcaacg cgggctaccg gcggctctgg aatgcgctca gccgtgccga ggccacggaa       300
     ctgcagatcg gggatctgtt cctgcagcat cccaagccca tgtgggtcta tgaccgcgac       360
     acccttgaat tcatcgccgt gaatgacgcg gccacccgct actacgggta ttcgcgtgag       420
     gcgatgctgg cgatgaacct ggccgatatc tgcccggaag aggacatctc acgcctgcat       480
     gcgctcatgc acagcccgca ggaccggcac cgcgacatcg gcgtggtgcg gcactgcaag       540
     cgctccggtg aagtggtttt tgtccacctg acggcgcatg cggtcgagtt catgcagcgc       600
     aaggcggaaa tggtgatggc catcgacgtc acggccgata tcctgtccaa gcatgccctt       660
     gaacgccagg aagcgcagtt tcggcaactc caccaaagtc tggccagcat cctgtggatc       720
     gcctcggccg acggccggac catgctctat gtcagtccgg cgctggagcg cgtctatggt       780
     tttgcgcccg aggcgatgca ggccaatccg gacctttggc tccaggtcgt ccatcccgat       840
     gatgcgcaca ttgcaaaagc gtccagtgtt gaactgatga ccgagggcga agcgagttgc       900
     gagtaccgga ttcgtgccac gtcgggcgag atcaaatggg tttcggaccg caagcggctc       960
     atcgtcgatg ccgaggggct ggtgacgatg atgggcggca ttctcgaaga catcacggct      1020
     gccaaggaac acgaggccct gcgtgccaga acgcatgttg aactcgaaag gctggtcacc      1080
     gagcgaaccg ctgaactggt gcgtgtcaat gccgaactcg acgcgtttgc caggaccatc      1140
     gcccacgatt tgaaggcgcc gctggtgtcg gtgatcggtt tctcccagct tcttcaaaac      1200
     cgccatgccg atacgctcaa ggaagacggt gtccggctga ttgcccggat cgggcgttcg      1260
     gcccggcaaa tggccagcct ggtcaatgac ctgctggccc tgtcgcgcgt ctccaagacc      1320
     gtgctggtca tcgaggacat cgaccttgtt cccctggcgc atgaaatcat cgaagagctg      1380
     cgcgagcagg agccccatcg ccaggtccgc ttcgagtcgc ctgcatcgct gcaggtgcgc      1440
     gcagacccgg gcctggtgcg gccgctgctg accaatctgc tgggcaacgc ctggaagttc      1500
     acgggcaagc gtgacgatgc ctgcgttcag ctactgctgg cgggcgcggc gcctgaagcg      1560
     actttctgcg tcagggacaa tggcgtgggc tttgacgcca gcagcagcga actgctgttc      1620
     aagccctttc agcgctttca cacgctgagc gaattcagcg gaaccggcat cggactgacg      1680
     acctgcgagc gaatcgttgc ccggcaccat gggcgcatct ggctcgaatc gaccgtgggc      1740
     gagggcacat cggtcttcgt caccctggcc cctcccgctc ccgatctgcc gcatctggcg      1800
     ccagcatga                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page