(data stored in ACNUC7421 zone)

EMBL: CP000529.PE167

CP000529.PE167       Location/Qualifiers
FT   CDS_pept        180176..180847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35494"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL6"
FT                   /protein_id="ABM35494.1"
FT                   /translation="MRLPSPITLGLAGLALLCGGAAVAQDIYSCVDARGRTITADRPIP
FT                   ECSDRTQRELSRNGLLKRQIGPSLTAHEQAAQDEKDRQAAEIRAREAEDKRRDRALLLR
FT                   YPTRAVHDQERTAALLQIDEVIKASIKRRGELADQRKAIASELEFYAKDLSRAPASLKR
FT                   RLEENEGSVAVQQKFIADQEQEKKRVNLRFDEELAKLKQLWPMVSPPIRPGASASKVGK
FT                   N"
     ttgcgcttgc cttcccccat caccttgggc cttgccggcc tggccttgct gtgcggcggc        60
     gccgccgtcg cccaggacat ctattcctgt gtggatgcac gaggccggac catcactgca       120
     gatcgcccga ttcccgaatg cagcgaccgc acgcagcgcg agctgtcacg caacggcctg       180
     ctcaagcgcc agatcggccc ttcgctcacg gcgcacgagc aggccgcgca ggatgaaaag       240
     gacaggcagg ccgccgagat tcgcgcccgc gaagccgaag acaagcgccg cgaccgggcc       300
     ttgctgctgc gttacccgac acgcgccgtg catgaccaag agcgcactgc cgcactgctg       360
     cagatcgacg aagtcatcaa ggcctccatc aagcgcaggg gcgaactggc cgatcagcgc       420
     aaggcgattg ccagcgaact ggagttttat gccaaggacc tgtccagggc gcccgcatcg       480
     ctcaagcgca ggctggaaga aaacgagggc agcgtcgcgg tgcagcaaaa gttcatcgcc       540
     gaccaggaac aggaaaaaaa gcgcgtcaac ctgcgctttg acgaagaact ggccaagctc       600
     aagcagctct ggccgatggt gagtccgccg atccggcccg gcgccagcgc ctcaaaagta       660
     ggcaagaact ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page