(data stored in ACNUC7421 zone)

EMBL: CP000529.PE171

CP000529.PE171       Location/Qualifiers
FT   CDS_pept        184476..185564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0173"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: pol:Bpro_0222 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35498"
FT                   /db_xref="GOA:A1VIM0"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM0"
FT                   /protein_id="ABM35498.1"
FT                   /translation="MLQRSFAHAPTGFLNMFEAFRRYFSTDLAIDLGTANTLIFARDKG
FT                   IVLDEPSVVAIRHEGGPHGKKVIQAVGREAKAMLGKVPGNIEAIRPMKDGVIADFVITE
FT                   QMIKQFIKMVHPRRLLTPSPRIIICVPCGSTQVERRAIKDAAEAAGAAAVYLIEEPMAA
FT                   ALGAGLPVSEASGSMVVDIGGGTTEVGVISLGGMVYKGSVRVGGDRFDEAIINYIRRNY
FT                   GMLIGEPTAEVIKKTIGSAFPGSEVKEMEVKGRNLSEGVPRSFTISSNEILEALTDPLN
FT                   QIVSAVKNALEQTPPELGADISDRGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTC
FT                   VVRGCGIALERMDRMGSIFTTE"
     atgctgcaac gaagttttgc gcatgcccca actggattcc tgaacatgtt tgaagcattc        60
     cgtcggtact tttccaccga cctggcgatt gatctgggca ccgccaacac cctgattttt       120
     gcgcgcgaca agggcattgt gctggacgag ccctcggtgg ttgcgattcg ccacgaaggc       180
     ggcccccacg gaaaaaaggt gattcaggcc gtcggccgcg aagccaaggc gatgctgggc       240
     aaggtgcccg gcaacatcga ggcgattcgc ccgatgaagg acggcgtgat cgccgacttc       300
     gtcatcaccg agcagatgat caagcagttc atcaagatgg tgcatccgcg ccgcctgctc       360
     acgccgagcc cgcgcatcat catctgcgtg ccctgcggct ccacccaggt cgagcgccgc       420
     gccatcaagg acgcggccga ggctgccggc gccgccgccg tctacctgat tgaagaaccg       480
     atggccgccg cgctgggtgc cggcctgccg gtgtcggagg ccagcggctc gatggtcgtc       540
     gatatcggcg gcggcacgac cgaagtcggc gtgatctcgc tgggcggcat ggtctataaa       600
     ggcagcgtgc gcgtcggcgg cgaccgcttc gacgaggcca tcatcaacta catccgccgc       660
     aactacggca tgctgatcgg cgagccgacg gccgaagtca tcaaaaagac catcggttcg       720
     gcctttccgg gctccgaagt caaggaaatg gaagtcaagg gccgcaacct gtccgaaggc       780
     gtgccgcgca gcttcacgat ttcaagcaat gaaatcctcg aagccctgac cgacccgctg       840
     aaccagatcg tctcggccgt caagaacgcg ctggagcaga cgccgcccga actcggcgcc       900
     gacatttccg accgcggcat gatgctgacc ggcggcggcg cgctgctgcg cgacctggac       960
     cgcctgctgg ccgaggaaac cggcctgccg gtgctggtcg ccgaagaccc gctgacctgc      1020
     gtggtgcgcg gctgtggcat tgcgctggag cgcatggacc gcatgggctc gatcttcacc      1080
     acggaataa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page