(data stored in ACNUC7421 zone)

EMBL: CP000529.PE173

CP000529.PE173       Location/Qualifiers
FT   CDS_pept        186561..187079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0175"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="PFAM: Rod shape-determining protein MreD; KEGG:
FT                   pol:Bpro_0224 putative rod shape-determining MreD
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35500"
FT                   /db_xref="GOA:A1VIM2"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM2"
FT                   /protein_id="ABM35500.1"
FT                   /translation="MIMRSGQQLLLPASPVFIWCTLIAALLLDMLPLGRIPWMPEFLAL
FT                   VLVFWSVHQPLKVGIGIAFMFGLAIDVHQTSLLGQHAFSYTMLSFLAAMIQRRLLWFTV
FT                   PLQALQVLPLFAAAHGAEIILRLLGGGVFPGWIVLLAPLAEALLWPVASVLLLVPQLRT
FT                   PDRDENRPL"
     atgatcatgc gttccggcca gcaactgctg ctgcccgcca gtccggtgtt catctggtgc        60
     accctgattg cggccttgct gctcgacatg ctgccgctgg gacgcatccc ctggatgccc       120
     gaatttctgg cgctggtgct ggtgttctgg agcgtgcacc agccgctcaa agtcggcatc       180
     ggcattgcct tcatgtttgg cttggcgata gatgtgcacc agacctcgct gctcgggcag       240
     catgcctttt cctacacgat gctgagtttt ttggcggcca tgatccagcg ccggctgctg       300
     tggttcacgg tgccgctgca ggcgctgcag gtgctgcccc tgttcgcggc ggcgcatggc       360
     gctgaaataa tccttcggct gctgggcggc ggcgtctttc cgggctggat cgtgctgctg       420
     gcgcccctgg ctgaggcgct gctgtggccg gtggccagcg tgctgctgct ggtgccgcag       480
     ctgcgcacgc ccgaccggga tgagaatcgc ccgctctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page