(data stored in ACNUC7421 zone)

EMBL: CP000529.PE176

CP000529.PE176       Location/Qualifiers
FT   CDS_pept        190631..192079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0178"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: bxe:Bxe_A4189 ammonium
FT                   transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35503"
FT                   /db_xref="GOA:A1VIM5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM5"
FT                   /protein_id="ABM35503.1"
FT                   /translation="MHAMRWIAVSLFFWLCLGLVTQQARAQAPAGAPTAALAAPALAVS
FT                   APPNDASVANAVMPVAPAALTQPGLVGAETLNGADTAWMMTSTALVLLMTLPGIALFYG
FT                   GMVRRKSVLNVMACVVGTCAIVSLLWFAVGYSIAFTPGSGALGHLLGGTDRLWFAGFDY
FT                   IKDAQKVAVSHIAPNIPESVYSMFQLSFAIITASLVVGAFVERMRFSATLIFMALWTVV
FT                   VYAPIAHWVWEPNGWLARLGALDFAGGSVVHINAGIAGLVCAYALGPRKGYGTEPFSPF
FT                   NLGLTMAGAGMLWVGWFGFNAGSAVAADGRAGLAMTVTHIAASAGALSWMAAEWLSRGR
FT                   PSLLGVCSGLVAGLVAITPGAGYVSPGSAVIFGLVAGVACYWGATGLKRLLNADDSLDV
FT                   FGVHGIGGIVGSLLTGVFASKTISGVEGSVWIQFVGAASVMLYSLVMTGLLLWITSLCV
FT                   GLRVSETAEIDGLDIDQHAERMGT"
     atgcatgcaa tgagatggat cgcagtgagt ttgttcttct ggctgtgcct gggcctggtg        60
     acccagcagg cccgcgccca ggcgcccgct ggcgccccga cggccgcact ggcggcccct       120
     gcgcttgcgg tttcggcacc gccgaatgat gcgagcgtgg ccaatgccgt catgcccgtg       180
     gccccggctg cgctgacgca gccgggcctg gtgggcgccg agaccctcaa tggtgcggac       240
     accgcctgga tgatgacctc gaccgcgttg gtgctgctga tgacgctgcc cggcattgcc       300
     ctgttttacg gcggcatggt gcggcgcaaa agcgtgctca atgtcatggc ctgcgtcgtg       360
     ggcacctgcg ccattgtcag cctgctgtgg tttgcggtcg gttattcgat tgccttcacg       420
     cccggcagtg gtgcgctggg ccaccttctg ggcggcacgg accggctctg gtttgccggc       480
     ttcgactaca tcaaggacgc gcaaaaggtc gcggtcagcc acatcgcgcc gaacattccc       540
     gaatcggtct attcaatgtt ccagctcagt tttgccatca tcacggcgtc gctggtggtc       600
     ggcgccttcg tcgagcgcat gcgcttttcg gccaccttga tcttcatggc gctgtggacg       660
     gtcgtggtct atgcgccgat tgcccactgg gtctgggagc ccaacggctg gctggcgcgc       720
     ctcggtgcgc tggattttgc cggcgggtcg gtggtgcaca tcaacgccgg cattgccggg       780
     ctggtctgcg cctacgctct cggcccgcgc aagggctatg gcaccgagcc gttctcgccc       840
     ttcaacctgg gcctgaccat ggccggcgcg ggcatgctgt gggtcggctg gttcggcttc       900
     aacgccgggt ctgccgtggc ggccgacggg cgggccggcc tggcgatgac ggtgacccac       960
     attgccgcgt ccgccggcgc cctgtcctgg atggcggccg agtggctgtc gcgcggccgc      1020
     ccttcgctgc tgggcgtgtg ctcgggcctg gtggccgggc tggtcgccat cacgccgggg      1080
     gccggttacg tgtcgccggg gtcggccgtg atctttggcc tggttgccgg cgtcgcctgc      1140
     tactggggcg ccaccggcct gaagcgcctg ctcaatgccg acgattcgct cgatgtattc      1200
     ggcgtgcatg gcataggcgg catcgtgggc tcgctgctca cgggcgtctt tgccagcaag      1260
     accatttccg gggtcgaagg cagtgtctgg atccagttcg tcggcgccgc aagcgtcatg      1320
     ctctacagcc tggtcatgac cggccttctg ttgtggatca cttccttgtg cgtcggcctg      1380
     cgcgtgagtg agacggcgga aatcgacggc ctggacattg accagcatgc cgaacgcatg      1440
     ggaacctga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page