(data stored in ACNUC7421 zone)

EMBL: CP000529.PE179

CP000529.PE179       Location/Qualifiers
FT   CDS_pept        194426..195370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0181"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bxe:Bxe_A0014 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35506"
FT                   /db_xref="GOA:A1VIM8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM8"
FT                   /protein_id="ABM35506.1"
FT                   /translation="MSLNFDPQTLRAFVAVARHGNVSRAAERLHLSQPAVSLQLKGLAA
FT                   NTGLTLFTRTPQGLTLTRDGAALLPQAEKALAALADFAQAALGLHSSVRGTLRIGTILD
FT                   PEFTRLGAFLKELVEAAPQIDTELRQGMSGNVLAQIVRGDLDVGFYLDRPEKSEANQGF
FT                   VQDGRAQAAIDFEVMELTRFTYRVIAPAGWGQQVQGRDWKALAALPWLATPPASVHHRL
FT                   LSRVFGAASLTGLEPRRVALVDQEASMLDLVKSGVGLSLARDSIAIRESQAHGLVVADR
FT                   VSLDCVLSFICLKARVAEPVVASAWGALAQAWR"
     atgagcctga actttgatcc ccaaaccttg cgcgctttcg tggccgtggc gcggcatggc        60
     aatgtctcgc gggcggctga gcgcctgcac ctgagccagc ctgcggtcag cctgcagctc       120
     aaggggctgg ccgccaacac cggattgacg ctgttcaccc gcacgccgca ggggctgacg       180
     ctcacgcgcg acggcgcggc gctgctgccg caggccgaaa aagccctggc ggcgctggcc       240
     gattttgcgc aggcggcgct ggggctgcac agcagcgtgc gcggcacgct gcgcatcggc       300
     accattctgg accccgagtt cacccggctc ggggcgttcc tgaaggagct ggtggaggcc       360
     gcgccgcaga tcgacaccga gctgcgccag ggcatgagcg gcaacgtgct ggcgcagatc       420
     gtccggggcg acctggatgt gggcttttac ctcgaccggc cagaaaaaag tgaagcaaat       480
     caggggtttg tgcaggatgg acgggcgcag gctgctattg attttgaagt catggagctg       540
     acgcgtttta cgtaccgcgt catcgcgccc gccggctggg gccagcaggt gcagggccgc       600
     gactggaagg cgctggccgc gctgccctgg ctggccacgc cgccggccag cgttcaccat       660
     cggctgctgt cgcgggtgtt tggcgcggcc tcgctgaccg gcctggagcc gcgccgcgtg       720
     gcgctggtgg accaggaagc gtcgatgctc gacctggtca aatccggcgt cggcctgagc       780
     ctggcgcgcg actccatcgc gatccgcgaa agccaggcgc atggcctggt ggtggcggac       840
     cgggtcagcc tggactgcgt gctgagcttc atctgcctga aggcgcgggt ggccgaaccc       900
     gtggtggcca gcgcctgggg cgcgctggcg caggcctggc gatga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page