(data stored in ACNUC7421 zone)

EMBL: CP000529.PE18

CP000529.PE18        Location/Qualifiers
FT   CDS_pept        16663..18579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0019"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   pol:Bpro_0037 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35345"
FT                   /db_xref="GOA:A1VI67"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VI67"
FT                   /protein_id="ABM35345.1"
FT                   /translation="MAKTNLSVDAADLTSRITRTPFPGSRKIYIEGSRPDIRVPFREVT
FT                   LTDTLVAEGSETRREANPPLRLFDSSGVYTDPAASIDITRGLSPLRGAWINERQDTEAL
FT                   PGISSAYGRERLNDPALSALRMAHAPVPRRAKAGANVSQMHYARQGIITPEMEYIAIRE
FT                   NLVRAQLAERLATERVPKTGHSFGASIPKDITAEFVRDEVARGRAVIPNNINHPETEPM
FT                   IIGRNFLIKVNANIGNSAVTSSIEEEVDKLAWSIRWGADTVMDLSTGENIHETREWILR
FT                   NSPVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVRLAYVPLT
FT                   ANRLTGIVSRGGSIMAKWCLSHHKESFLYEHFEEICEIMKAYDVCFSLGDGLRPGSIAD
FT                   ANDEAQFAELHTLGELTQIAWKHDVQVMIEGPGHVPLQLVKENVEKQLEACFEAPFYTL
FT                   GPLITDISPGYDHISSAMGAANIGWYGTAMLCYVTPKEHLGLPNRDDVKQGLIAYKIAA
FT                   HAGDLAKGYPGAQMWDNAVSKARFEFRWEDQFRLAIDPDTAMAYHDETLPKENAKVAHF
FT                   CSMCGPKFCSMKISQEVREFARLNPSTTTLAKAPGVIPIQQVSSGFEEKAEEFRKGGNE
FT                   IYS"
     atggccaaaa ccaatctttc cgtcgatgca gcggacctga ccagccgcat cacccgcacg        60
     ccttttccgg gttcgcgcaa gatctacatc gaaggctcgc gccccgacat ccgcgtgccg       120
     tttcgcgaag tcacgctcac cgacacgctg gtggccgaag gcagtgaaac ccgccgcgag       180
     gccaatccgc cgctgcgcct gttcgactcg tcgggcgtgt acaccgaccc ggcagcaagc       240
     atcgacatca cgcgcggcct gtctccgctg cgcggcgcct ggatcaacga gcgccaggac       300
     accgaagccc tgcccggcat cagcagcgcc tacggccgcg agcgcctgaa cgacccggcc       360
     ctcagcgcgc tgcgcatggc ccacgcgccc gtgccgcgcc gcgccaaggc gggcgccaac       420
     gtgtcgcaga tgcattacgc gcgccagggc atcatcacgc cggagatgga atacatcgcg       480
     atccgcgaaa acctggtgcg cgcccagctt gccgaacgcc tggcgaccga gcgcgtgccg       540
     aaaaccggcc attcgttcgg cgcgtcgatt ccgaaagaca tcaccgccga attcgttcgc       600
     gacgaagtgg cgcgcggccg cgccgtgatt ccgaacaaca tcaaccaccc cgaaaccgag       660
     ccgatgatca tcggccgcaa cttcctgatc aaggtcaacg ccaacatcgg caactcggcc       720
     gtcacctcgt cgattgaaga ggaggtggac aagctggcct ggtcgatccg ctggggggcc       780
     gacaccgtga tggacctctc gaccggcgag aacatccacg aaacccgcga atggattctg       840
     cgcaattcgc cggtgccgat tggcacggtg ccgatttacc aggcgctgga aaaagtcaac       900
     ggcaaggccg aagacctgac ctgggaaatc ttccgcgaca cgttgatcga gcaggccgag       960
     cagggcgtgg actatttcac catccacgcc ggcgtgcgcc tggcctatgt gccgctgacc      1020
     gcgaaccgcc tgaccggcat cgtctcgcgc ggcggctcga tcatggcgaa atggtgtttg      1080
     tcgcaccaca aggaaagctt tttgtacgag catttcgagg agatttgcga aatcatgaag      1140
     gcctacgacg tctgcttctc gctcggcgac ggcctgcgcc ccggctcgat tgccgacgcc      1200
     aatgacgaag cgcagttcgc cgaactgcac acgctgggcg aactcacgca gatcgcctgg      1260
     aagcacgacg ttcaggtgat gatcgaaggc cccggccatg tgccgctgca gctggtcaag      1320
     gaaaacgtcg agaagcaact cgaagcctgc tttgaagcgc cgttctacac gcttggcccc      1380
     ttgatcaccg acatctcgcc cggctacgac catatttcgt cggcgatggg cgcggcgaat      1440
     atcggctggt acggcacggc catgctgtgc tacgtgacgc ccaaggagca tctgggcctg      1500
     ccgaaccgcg acgacgtgaa gcagggcctg atcgcctaca agatcgccgc gcatgcgggc      1560
     gacctggcca agggctaccc gggcgcgcag atgtgggaca acgcggtcag caaggcgcgc      1620
     ttcgagttcc gctgggaaga ccagttccgc ctggcgattg accccgacac ggcgatggcc      1680
     taccacgatg aaacgctgcc caaggaaaac gccaaggtgg cgcatttctg ctcgatgtgc      1740
     gggccgaagt tctgctcgat gaagatttcg caggaagtgc gcgagtttgc gcggctgaat      1800
     ccgtccacca cgacgctggc caaggcgccg ggcgtgattc cgatccagca ggtcagcagc      1860
     ggcttcgagg aaaaagccga ggagttccgc aagggcggga acgagattta ctcctga         1917
//

If you have problems or comments...

PBIL Back to PBIL home page