(data stored in ACNUC7421 zone)

EMBL: CP000529.PE180

CP000529.PE180       Location/Qualifiers
FT   CDS_pept        195478..196626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0182"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   pol:Bpro_0230 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35507"
FT                   /db_xref="GOA:A1VIM9"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM9"
FT                   /protein_id="ABM35507.1"
FT                   /translation="MPMEDSPPRIEVQHGPEGRVLLQGAWTAANLTQKPLWDALAAQLK
FT                   ALRAQTASSASPAALRWSLSPLEKLDYLGAQVLWSAWNHHWPAGLQIEPEQRAMLETVE
FT                   KFTVRPLPPPRPSWLEPVLMLGERLLSLLSHAKGMLRLLGQLLLDMGRLVRHPQQGPWR
FT                   DLSGHLYNFGATALPITALVGFLIGVVLAYLISQQLRQFGADAFIVNILGISLIRELGP
FT                   VLAAILIAGRSGSAITAQIGVMRVTEELDAMRVMGIARGFRLVMPRAMALALVMPLISV
FT                   WTTIAALLGGMLAADISMGVTPSFFFNALPAAVKVSNLVLATAKSVVFGLLIALIGCHY
FT                   GLRVKPNTESLGQGTTASVVTSITVVILVDALFAVLFKSVGI"
     atgcccatgg aagactcccc gccgcgaatt gaagtccagc acggccctga aggccgggtg        60
     ctgctgcagg gggcgtggac ggcggcgaac ctgacgcaaa aaccgctctg ggacgcgctg       120
     gcggcgcaac tcaaggcctt gcgcgcccaa accgcatctt ccgcatcccc cgccgcgctg       180
     cgctggagcc tgtcgccgct tgaaaagctc gattacctgg gcgcccaggt gctgtggagc       240
     gcgtggaatc accactggcc cgccggcttg cagatcgagc ccgagcagcg cgccatgctc       300
     gaaacggttg aaaaattcac cgtcaggccg ctgccgccgc ccaggccttc gtggcttgag       360
     ccggtgctga tgctgggcga gaggctgctc agcctgctgt cccatgccaa gggcatgctg       420
     cgcctgctgg gccagctgct gctcgacatg ggccggctcg tgcggcaccc gcagcagggg       480
     ccgtggcgcg atctctcggg ccatctctac aacttcggcg cgaccgcgct gccgatcacg       540
     gcgctggtgg gctttttgat cggcgtggtg ctggcctacc tgatttctca gcagctgcgc       600
     cagttcggcg ccgacgcctt catcgtcaac atcctgggca tttcgctgat ccgcgaactc       660
     ggcccggtgc tggcggccat tttgatcgcc gggcgcagcg gctcggccat caccgcgcag       720
     attggcgtga tgcgcgtgac cgaagagctg gacgcgatgc gcgtcatggg catcgcgcgc       780
     ggctttcgcc tggtgatgcc gcgcgccatg gcgctggcgc tggtgatgcc gctgatcagc       840
     gtctggacca cgattgccgc cttgctgggc ggcatgctgg cggccgatat ttcgatgggc       900
     gtgacgccct cgtttttctt caacgcgctg ccggcggccg tgaaggtgtc gaatctggtg       960
     ctggcgaccg ccaagtcggt ggttttcggc ctgctgattg cgctgatagg ctgccattac      1020
     ggcctgcgcg tcaagcccaa taccgaaagc ctggggcagg gcacgacggc ttcggtggtc      1080
     acgtcgatca ccgtcgtcat cctggtcgat gcgctgttcg cggtgctgtt caagagtgtc      1140
     ggcatatga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page