(data stored in ACNUC7421 zone)

EMBL: CP000529.PE187

CP000529.PE187       Location/Qualifiers
FT   CDS_pept        complement(201305..201871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0189"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   tbd:Tbd_1949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35514"
FT                   /db_xref="GOA:A1VIN6"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN6"
FT                   /protein_id="ABM35514.1"
FT                   /translation="MSILSRIHAGPGATQASADDLTRDNVESMRRVEEQAMAKRSRADR
FT                   IAAFVASFCGSMPFVWLHVLLFFVWLALNSWPGIHHFDPYPFTFLTLVVSLEAIFLSAF
FT                   ILISQNYELRISDRRNQLDLQINLLTEQENTKMLQLLEQIAAKVGVDVSGDAELRFLKQ
FT                   VTHPEKLIAQIEHAQQERPLKTSSV"
     atgtctattt tgtcccgcat ccatgccggc cctggcgcga cccaggccag cgccgatgac        60
     ctgacacggg acaacgtgga gtcgatgcgc cgggtcgagg aacaggccat ggccaaacgc       120
     agccgcgccg accgcatcgc cgctttcgtg gccagctttt gcggctccat gccctttgtc       180
     tggctgcatg tgctgctgtt tttcgtctgg ctggcgctga actcgtggcc gggcatccat       240
     catttcgacc cctacccgtt cacttttctg acactggttg tttcgctgga ggcgattttc       300
     ctgtcggcct tcattttgat cagccagaac tatgaactgc gcatcagcga ccggcgcaac       360
     cagctggacc tgcagatcaa cctgctgacc gagcaggaaa acaccaagat gctccagttg       420
     ctggagcaaa ttgccgcgaa agtgggggtt gacgtgagcg gtgatgccga gctgcgcttt       480
     ctcaagcagg tcacccaccc cgaaaagctg attgcccaga tcgaacacgc ccagcaggaa       540
     cgcccgctga agacgtcttc ggtttaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page