(data stored in ACNUC7421 zone)

EMBL: CP000529.PE192

CP000529.PE192       Location/Qualifiers
FT   CDS_pept        205816..207012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0194"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: pol:Bpro_0247 VanZ
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35519"
FT                   /db_xref="GOA:A1VIP1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP1"
FT                   /protein_id="ABM35519.1"
FT                   /translation="MSRPLQGGAELHAAKRSEDVGGVPYSSVGDGQKTTAWPLALVLVC
FT                   LIIYASLYPFSEWRNQGISPLRFLTSPLPKYWTGFDVGTNLLGYAPLGFLLALSALRSR
FT                   RVAWAVSVSVLGAALLSLAMESLQSYLPSRIPSNVDLALNTLGAWLGACCALALERSGL
FT                   VGRWGRVRARWFSPDARSVLVLLLLWPLALLFPAAVPMGLGQVFERLETALADALADTP
FT                   FLEWMPMREVELQPLVPIAELVCVALGVLIPCLLGYCVVRTLWQRAVFAAATIALGLGA
FT                   SALSAALSYGPEHAWAWLDAPVRVGIGLAVVLAVLLLALPRRVAAALALLALAIHLSLL
FT                   NQAPADPYFAQTLQIWEQGRFIHFYGLVQWLGWLWPYAALTCLVARLSSHEPQAAAEK"
     atgagtcgcc ccctgcaagg gggggcggaa ctacacgcag cgaagcgcag tgaggacgtc        60
     gggggtgtgc catattcctc cgtcggggat gggcaaaaga ccaccgcctg gccgctggcc       120
     ctggtgctgg tgtgcctgat catttatgcc agcctttatc cgttttcgga gtggcgcaac       180
     cagggcattt cgccgctgcg tttcctgacc tcgcccttgc ccaaatactg gaccggtttt       240
     gatgtcggca ccaatttgct gggttatgcg ccgctgggct ttttgctggc cctgtcggcg       300
     ctgcgcagcc ggcgcgtcgc ctgggcggtc agcgtgtcgg ttcttggcgc tgcactgctg       360
     tcgctggcga tggaatcgct gcagagttat ttgccgtcgc gcattccttc gaatgtcgat       420
     ctggcgctga acacgctggg cgcctggctg ggcgcctgct gcgccctggc gctggagcga       480
     tccgggctgg tgggccgctg gggccgcgtg agggcgcgct ggttttcgcc cgatgcgcgc       540
     agcgtgctgg tgctgctgct gctgtggccg ctggccttgc tgtttccggc tgcggtgccg       600
     atgggcctgg gccaggtgtt cgagcggctg gagacggcgc tggccgatgc gctggccgac       660
     acgcctttcc tggagtggat gccgatgcgc gaggtcgaac tccagcccct ggtgcccatc       720
     gccgagctgg tctgcgtggc gctgggcgtg ctgattccct gcctgctcgg ctattgcgtg       780
     gtccgcacgc tgtggcagcg cgcggtgttt gccgccgcga cgattgcgct cggcctgggc       840
     gcgtcggccc tgtcggcggc gctcagctac gggccggaac acgcctgggc ctggctcgat       900
     gcgccggtgc gggtcggcat cggactggcc gtggtactgg ccgtgctgct gctggccttg       960
     ccgcgccgcg ttgccgccgc gctggcgctg ctggcgctgg ccattcacct gagcctgctc      1020
     aaccaggcgc ccgccgaccc ttactttgcc cagacactgc aaatctggga gcagggccgg      1080
     ttcatccatt tctatggcct ggtgcagtgg ctgggctggc tctggccgta tgcggcattg      1140
     acctgcctgg tggcaaggct ttccagccac gaaccgcaag cagccgctga aaagtaa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page