(data stored in ACNUC7421 zone)

EMBL: CP000529.PE193

CP000529.PE193       Location/Qualifiers
FT   CDS_pept        207022..207393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0195"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: pol:Bpro_0248 ferredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35520"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP2"
FT                   /protein_id="ABM35520.1"
FT                   /translation="MTLAATQTTSSDAAKPDSYYERHIFFCLNQRTGEPCCADQGAQQA
FT                   FDRCKSLVKAAGLAGPGKVRVNKAGCLDRCAGGPVAVVYPEAVWYSYVDASDIDEIVES
FT                   HLLNGQVVERLLTPPHLGR"
     atgactcttg ctgccaccca aaccacttcg tccgatgccg ccaagccgga ctcctattac        60
     gaacgccaca tcttcttttg cctgaaccag cgcactggcg agccgtgctg cgccgaccag       120
     ggcgcgcagc aggcgttcga ccgctgcaag tcgctggtca aggccgccgg gctggccggg       180
     ccgggcaagg tgcgggtcaa caaggccggc tgcctggacc gctgcgccgg cggcccggtg       240
     gcggtggtct atccggaggc ggtctggtac agctatgtgg acgccagcga catcgacgag       300
     attgtcgagt cgcacctgtt gaacggccag gtggtcgagc gcctgctgac gccgccgcat       360
     ctggggcgct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page