(data stored in ACNUC7421 zone)

EMBL: CP000529.PE194

CP000529.PE194       Location/Qualifiers
FT   CDS_pept        207513..208157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0196"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pol:Bpro_0249 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35521"
FT                   /db_xref="GOA:A1VIP3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP3"
FT                   /protein_id="ABM35521.1"
FT                   /translation="MNSKTQKSSIAGPAGALDIALDLPAGESRGIAVIAHPHPLFGGTL
FT                   DNKVVQTLARAFVQTGWTAVRFNFRGVGGSAGSHDEGRGELEDFLAVVQHVAPAGEGQA
FT                   ALALAGFSFGAFVTTHAFERLHAGRPIEKLVLVGTSVSRAPAAPVDAAAHNKTLVVHGE
FT                   QDDTVLLSAVMDWARPQALPVTVVPGVGHFFHGQLPLLKNLVIRHLASPAV"
     atgaactcta aaacccaaaa gtccagcatc gcaggcccgg ccggcgcgct ggacattgcg        60
     ctggacctgc cggctggcga atcacgcggc atcgccgtga ttgcccatcc gcatccgctg       120
     ttcggcggca cgctggacaa caaggtggtg cagacgctgg cgcgggcttt cgtgcagacc       180
     ggctggacgg cggtgcgctt taactttcgc ggcgtcggcg gcagcgccgg cagccatgac       240
     gaaggacgcg gcgaactgga ggattttctg gcggtggtgc agcatgtggc gcccgccggc       300
     gaaggccagg ccgcgctggc gctggccggg ttctcgttcg gtgcttttgt caccacccat       360
     gcctttgaac gcctgcatgc cggccgcccg atagaaaagc tggtgctggt cggcaccagc       420
     gttagccgcg cccccgctgc gccggtggat gccgccgcgc acaacaaaac cctggtggtg       480
     catggcgagc aggacgacac cgtgctgctg tcagccgtga tggactgggc gcgtccgcag       540
     gcactgcctg tcacggtggt gccgggggtt ggtcatttct ttcatggaca attgccgctg       600
     ctgaaaaatc tggtgattcg ccacctggct tcgcctgcgg tttga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page