(data stored in ACNUC7421 zone)

EMBL: CP000529.PE198

CP000529.PE198       Location/Qualifiers
FT   CDS_pept        210853..212955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0200"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: pol:Bpro_0253 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35525"
FT                   /db_xref="GOA:A1VIP7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP7"
FT                   /protein_id="ABM35525.1"
FT                   /translation="MSRATPIKNYRNIGISAHIDAGKTTTTERILFYTGVSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWKGMDSTLGEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVVEGMKLRLK
FT                   ANPVPMVIPIGAEENFTGVVDLLMMKAIIWDEASQGMKFEYRDIPADLVDTANEWREKM
FT                   VEAAAEANEELMNKYLEEGDLSEAEIKFGIRARTIASEIQPMYCGSAFKNKGVQRMLDA
FT                   VIEFMPSPIDIPPVKGTDDDEEPVTRMADDSEKFAALAFKLMTDPFVGQLTFVRVYSGV
FT                   LKKGDTVYNPIKGKKERIGRIVQMHANERQEVSEIVAGDIAACVGLKDVTTGETLCDPD
FT                   AIIMLERMVFPEPVIAQAVEPKTKADQEKMGIALQRLAAEDPSFRVKTDEESGQTIIAG
FT                   MGELHLEIIVDRMKREFGVEANVGKPQVAYRETIRKTIEDAEGKFVRQSGGKGQYGHVV
FT                   LKIEPNEPGKGIEFIDAIKGGVVPREYIPAVEKGINEAVTSGVLAGYPVVDVKVTLHFG
FT                   SYHDVDSNELAFKMAAIFGFKEGCRKAGPVILEPMMAVEVETPEDYAGNVMGDLASRRG
FT                   MVQGMEDMVGGGKAIKAEVPLSEMFGYSTTLRSATQGRATYSMEFKHYTEAPRNVSEAI
FT                   MAARAK"
     atgtcccgcg ctacccccat taaaaactac cgcaatattg gtatttccgc gcacattgat        60
     gccggcaaga ccaccaccac cgagcggatt cttttctaca ccggcgtgag ccacaagatc       120
     ggtgaagttc acgatggcgc cgccacgatg gactggatgg agcaggagca ggagcgtggc       180
     atcacgatta cctctgccgc caccacctgc ttctggaagg gcatggactc gaccttgggc       240
     gaacaccgca tcaacatcat cgacaccccg ggccacgttg acttcacgat tgaagtcgag       300
     cgctcgatgc gcgtgcttga cggtgcctgc atggtttact gcgccgtggg tggcgtgcag       360
     ccccagtccg aaactgtctg gcgtcaggcc aacaagtaca aagtgccgcg tctggccttt       420
     gtcaacaaga tggaccgcac cggcgcgaac ttcttcaagg tcgtcgaggg catgaagctg       480
     cgcctgaagg ccaaccctgt gcccatggtg atccctatcg gcgctgaaga aaacttcacc       540
     ggcgtggtcg atctgctgat gatgaaggcc atcatctggg atgaagcctc gcagggcatg       600
     aagtttgagt accgtgacat tccggccgat ctggtggaca cggccaatga atggcgcgaa       660
     aagatggtcg aggctgcagc cgaagccaac gaagagctga tgaacaaata cctcgaagaa       720
     ggcgatttgt ccgaagcaga aattaagttc ggcattcgtg cccgcacgat tgccagcgaa       780
     atccagccga tgtactgcgg ctcggccttc aagaataagg gcgtgcagcg catgctggac       840
     gccgtgattg aattcatgcc ttcgccgatc gacattccac ctgtcaaggg cacggatgat       900
     gatgaagagc ctgtcacccg catggccgat gactctgaaa agtttgccgc tctggcgttc       960
     aagctgatga ccgacccgtt cgtgggccag ttgacctttg tgcgcgtcta ttccggcgtg      1020
     ctgaaaaagg gcgacactgt ttacaacccc atcaagggca agaaagagcg tatcggccgt      1080
     atcgtgcaga tgcacgccaa cgaacgtcag gaagtcagtg aaatcgtcgc gggtgacatc      1140
     gcagcctgcg tgggcttgaa agacgtgacc accggcgaga cgctgtgtga tcccgatgcc      1200
     atcatcatgc tggagcgcat ggtgttccct gagcccgtga ttgcccaggc cgtcgagccg      1260
     aaaaccaagg ctgaccagga aaaaatgggt atcgccctgc agcgcctggc cgcggaagat      1320
     ccatcgttcc gcgtcaagac cgacgaagaa tcgggccaga ccatcatcgc cggcatgggc      1380
     gagctgcatc tggaaatcat cgttgaccgc atgaagcgcg aattcggcgt tgaagccaac      1440
     gtcggaaagc cgcaagtggc ctaccgcgaa accatccgca agacgattga agatgccgaa      1500
     ggcaagttcg tgcgtcagtc cggcggcaag ggccagtacg gccatgtggt gctcaagatc      1560
     gagccgaacg agcctggcaa gggtatcgag ttcatcgacg cgatcaaggg cggtgtggtt      1620
     cctcgcgaat acattcctgc ggtggaaaag ggtatcaacg aagccgtgac gtcgggcgtg      1680
     ctcgccggtt acccggtggt tgacgtcaag gtcacgctgc acttcggctc ttaccacgac      1740
     gtggactcga acgaactcgc gttcaagatg gccgcgattt ttggcttcaa ggaaggctgc      1800
     cgcaaggctg gcccggtcat tcttgagccg atgatggccg tcgaagtcga aacgcctgag      1860
     gactatgccg gcaacgtgat gggcgatctg gcctcacgcc gcggcatggt gcagggcatg      1920
     gaagacatgg tcggtggtgg caaggccatc aaggctgaag tgcccttgtc cgaaatgttc      1980
     ggctactcga ccacgctgcg ttctgcaact cagggtcgtg cgacctactc gatggagttc      2040
     aagcactaca ccgaagcgcc gcgcaatgtg tccgaagcca tcatggctgc ccgcgcgaag      2100
     taa                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page