(data stored in ACNUC7421 zone)

EMBL: CP000529.PE200

CP000529.PE200       Location/Qualifiers
FT   CDS_pept        214321..214635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0202"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: pol:Bpro_0255
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35527"
FT                   /db_xref="GOA:A1VIP9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIP9"
FT                   /protein_id="ABM35527.1"
FT                   /translation="MATKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPT
FT                   RMKRFDILRSPHVNKTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ
FT                   "
     atggccacca agcaaaaaat ccgtatccgt ctcaaagcgt ttgactacaa actgattgac        60
     cagtcagccg ccgagatcgt tgacaccgcc aagcgcaccg gcgcgattgt caagggaccc       120
     gtgcccctgc caacccgcat gaagcgcttt gacatcctgc gttcgcccca cgtcaacaag       180
     acgagccgcg accagctgga aatccgcacg caccagcgcc tgatggacat cgttgacccc       240
     acggacaaga ccgttgacgc gttgatgaag ctcgatctgc ctgctggcgt ggacgtcgaa       300
     atcaagctgc agtaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page