(data stored in ACNUC7421 zone)

EMBL: CP000529.PE201

CP000529.PE201       Location/Qualifiers
FT   CDS_pept        214874..215554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0203"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: pol:Bpro_0256
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35528"
FT                   /db_xref="GOA:A1VIQ0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ0"
FT                   /protein_id="ABM35528.1"
FT                   /translation="MSLSNSLGLLGRKVGMMRLFTDDGDTVPVTVVDVSNNRVTQVKTE
FT                   ANDGYDALQVAFGSRKASRVTKPEAGHLAKAGVEAGEILKEFRVTADVAGKYAAGTVVP
FT                   AADIFAVGQLVDVQGTSIGKGFAGTIKRHKMSSQRASHGNSRSHNVPGSIGMAQDPGRV
FT                   FPGKRMTGHLGDVTKTTQNLDIVRIDEARQLLMIRGAVPGSKGGFVTVRAAIKAKPTAA
FT                   KGAN"
     atgagtctga gcaactccct cgggttgctg ggccgcaagg tgggcatgat gcgtctgttc        60
     actgatgatg gggacacagt tcctgtcaca gtggtggatg tgtcaaacaa ccgcgtgacc       120
     caggttaaaa ccgaagcaaa tgacggctac gatgccctcc aagtggcatt tggctcgcgc       180
     aaagcatcgc gcgtgaccaa gcctgaagcc ggccaccttg cgaaagcagg cgttgaagct       240
     ggtgaaatcc tgaaagaatt ccgcgtgacg gctgacgttg caggtaaata tgccgctggt       300
     accgttgtgc ccgctgctga tatctttgct gtcggccagt tggtggatgt gcagggtact       360
     tccattggta aaggctttgc cggcaccatc aagcgtcaca agatgagctc gcagcgcgcg       420
     tcgcacggta acagccgttc gcacaacgtt cccggctcca tcggcatggc gcaggatcct       480
     ggtcgcgtgt ttcctggtaa acgcatgacg ggccatctgg gtgatgtcac caagaccacg       540
     caaaacctcg acatcgtgcg cattgacgaa gcccgtcaac tgctgatgat ccgtggcgcc       600
     gtgcctggtt ccaaaggcgg ttttgtgacg gttcgcgccg ccatcaaggc caaaccaacc       660
     gctgccaaag gagcgaactg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page