(data stored in ACNUC7421 zone)

EMBL: CP000529.PE202

CP000529.PE202       Location/Qualifiers
FT   CDS_pept        215554..216174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0204"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: pol:Bpro_0257
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35529"
FT                   /db_xref="GOA:A1VIQ1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ1"
FT                   /protein_id="ABM35529.1"
FT                   /translation="MQVELLNDQGLSSSKVDVSDTVFGREYNESLIHQVIVAFQANARQ
FT                   GTRAQKDREQVRHSTKKPFKQKGTGRARAGMTSSPLWRGGGRIFPNMPDENFTHKINKK
FT                   MYRAGMASIFSQLAREGRLAVVDSLTVDSPKTKVLADKFKAMNLNSVLVIADQVDENLY
FT                   LASRNLVNILVVEPRYADPLSLVHYKKVLVTKAAMDQLKEMFA"
     atgcaggtcg aactcctgaa tgaccagggt ctgtcatcgt ccaaagtgga cgtgtccgac        60
     accgtttttg gtcgcgaata caacgaaagc ctgattcatc aggtgatcgt ggccttccag       120
     gccaacgccc gccagggcac ccgtgcccag aaggaccgtg agcaggttcg tcactcgacc       180
     aagaagcctt ttaaacaaaa gggcactggc cgcgcacgtg caggtatgac gtcttccccg       240
     ctgtggcgcg gaggcggtcg tattttcccg aacatgcctg atgaaaactt cacgcacaag       300
     atcaacaaga aaatgtatcg tgccggcatg gcttcgatct tttcgcagct ggcgcgcgaa       360
     ggccgcctgg ctgtggttga ttccctgacc gtggattcac ccaagacgaa agttctggct       420
     gacaaattca aggccatgaa cctcaactcg gtgctggtga ttgctgatca ggttgatgaa       480
     aacctgtacc tggcatcgcg caatctggtc aacatcctgg ttgttgagcc ccgctatgcc       540
     gacccgctgt cactggtgca ctacaaaaag gtgctcgtga ccaaggctgc catggaccaa       600
     ctcaaggaga tgttcgcatg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page