(data stored in ACNUC7421 zone)

EMBL: CP000529.PE203

CP000529.PE203       Location/Qualifiers
FT   CDS_pept        216171..216497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0205"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: pol:Bpro_0258
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35530"
FT                   /db_xref="GOA:A1VIQ2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ2"
FT                   /protein_id="ABM35530.1"
FT                   /translation="MSAVNAQTKYDEGRLMQVLVAPIVSEKATMIAEKSNSVTFKVLQD
FT                   ATKYEIKAAVELMFKVNVKAVAVLNIKGKTKRFGKSVGRRDNLRKAYVTLQAGQELNLG
FT                   GESA"
     atgagcgccg tgaacgccca aaccaaatat gacgaaggcc gcctgatgca ggttttggtc        60
     gctcccatcg tgtctgaaaa ggccacgatg attgcggaaa aatccaattc ggtcaccttc       120
     aaggtcctgc aggacgctac caagtatgaa atcaaggccg ctgtggaatt gatgttcaag       180
     gtaaacgtca aggctgtggc cgtactgaac atcaaaggca agaccaagcg ctttggcaag       240
     tctgtaggcc gccgggacaa cctgcgcaaa gcctacgtga cgctgcaggc cggtcaagag       300
     ctgaacctcg gtggggagtc cgcataa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page