(data stored in ACNUC7421 zone)

EMBL: CP000529.PE219

CP000529.PE219       Location/Qualifiers
FT   CDS_pept        225998..227326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0221"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   bpe:BP2153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35546"
FT                   /db_xref="GOA:A1VIR8"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR8"
FT                   /protein_id="ABM35546.1"
FT                   /translation="MQAAARQTARLPGMQSPTEIQQHLDSVEDAFRRARLRAMQRVAGG
FT                   LLLLAFAVFCLARSLSGLHPAWGYVEAFAEAAMVGAVADWFAVVALFRHPLGIPVWHTA
FT                   IIANSKDDIGRNLGQFVESYFVTEEGIAQRIRQANPAGLLGAWLLAPGHAAQLGHATAK
FT                   ALKALLNALDDPSMSQLLKDAAAGQLARFDISANAGQLLDLLVAEGKHQQLLNSVLHSL
FT                   GDYLSEETNQQQATDFLIAAFGVENVLYKVGTAAIGPRALRSLSRSAHEVLEDPAHPAR
FT                   ERFNGWVQNFVLHLKDDPQWREFIVRHQQDTLANERVQALLGGLWGRVKARLLDDLGRD
FT                   DPAMARQISVLARKVGQALAQDARLVEGLNGAIESGSVLLVRNYRGEVGHFIEAKLAQW
FT                   TREEMTDRIELAIGRDLQFIRINGTLVGGLVGLAIYSVTRLLG"
     atgcaggcgg ccgcgcgcca aacggctaga ctgcccggca tgcaatcccc taccgaaatt        60
     caacagcatc tggactccgt cgaagatgcc ttcaggcgcg cccggctgcg cgccatgcag       120
     cgggtggccg gcggcctgct gttgctggcc tttgcggtgt tttgcctggc ccgcagcctg       180
     tccgggctgc atcccgcctg gggctatgtg gaagcttttg ccgaagcggc catggtcggc       240
     gcggtggcgg actggtttgc cgtcgtcgcg ctgtttcgcc atccgctggg cattccggtg       300
     tggcacacgg ccatcattgc gaacagcaag gacgacatcg ggcgcaatct gggccagttt       360
     gtcgaaagct atttcgtgac cgaagaaggc attgcccagc gcatccggca ggccaacccg       420
     gccggcctgc tcggcgcctg gctgctggcg cccggccatg cggcgcagct gggccatgcc       480
     acggccaaag ccttgaaggc actgctcaat gccctggatg acccatcgat gagccagttg       540
     ctgaaggatg cggccgccgg gcagctggcc cgcttcgaca tctcggccaa cgccgggcaa       600
     ctgctggacc tgctggtggc cgagggcaag caccagcaat tgctcaacag cgtgttgcac       660
     agcctgggcg actacctgag cgaggaaacc aaccagcagc aggccaccga tttcctgatt       720
     gccgcgttcg gcgtcgaaaa cgtgctctac aaggtcggaa cggccgccat cggtccgagg       780
     gcgttgcgct cgctgagccg gtcggcccat gaggtgctgg aagaccccgc gcatccggcc       840
     cgcgagcgtt tcaacggctg ggtgcaaaac ttcgtgctgc acctcaagga cgatccgcaa       900
     tggcgggagt tcatcgtcag gcaccagcag gacaccctgg ccaatgaacg ggtgcaggcc       960
     ttgctcggcg gcctgtgggg ccgggtcaag gcgcgcctgc tcgatgacct gggccgggac      1020
     gatccggcca tggcccggca gatttcggtg ctggcgcgca aggtcgggca agcgctggcg      1080
     caggatgcgc ggctggtcga ggggctcaac ggcgccatcg agtcgggcag cgtcctgctg      1140
     gtgcgcaatt accggggcga ggtggggcac ttcatcgagg cgaaactggc ccagtggacg      1200
     cgcgaggaaa tgaccgaccg catcgaactg gccatcgggc gtgacctgca gttcatccgc      1260
     atcaacggca cgctggttgg cgggctggtc gggctggcca tctacagcgt gacccgtttg      1320
     ctcggttga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page