(data stored in ACNUC7421 zone)

EMBL: CP000529.PE222

CP000529.PE222       Location/Qualifiers
FT   CDS_pept        229582..230601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0224"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein, LacI;
FT                   KEGG: bcn:Bcen_4095 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35549"
FT                   /db_xref="GOA:A1VIS1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS1"
FT                   /protein_id="ABM35549.1"
FT                   /translation="MDLKQLSASLGLSPTTVSRALNGYPEVSERTRERVIEAAKEVGYE
FT                   PNVTARRLARGAVDAIGIVHPTGAGHLDDPRFLEVVDGLTERFSKAGIDLLIASARQKE
FT                   EVATYKRLLQGRRVDGFIVHHTRRVDPRLDYLQECGAPFVAYGRTDTPDSYAWFDFDNA
FT                   LGSSLAVRRLQEFGHRRIAYMHAPLELHFAYQRYQGYLDAMHAAGLPVDPGLVVPAGFG
FT                   RRGGYEAMKTLLDRAEGPTAVIVDNNLCGVGVLRCALDAGLKIGRQLSLIVYDGVPVDS
FT                   VVTSVQVTSIEQPTSYAVGVQLAELMIGVLAGQPVQELQTLWSPRIAAGSSDGPISEH"
     atggacctca aacagctttc cgctagcttg ggcctttctc cgactacggt aagtcgggcc        60
     ttgaatggat atcccgaggt tagtgagcgc acccgggagc gcgtcatcga ggccgcaaag       120
     gaagtgggat acgagccgaa cgtgacggcg cgacgccttg cgcgaggtgc cgtggacgcc       180
     atcggcatcg ttcaccccac cggagccggc catctggatg acccccgatt tctggaggtg       240
     gtggatgggc tgactgaacg gttttccaaa gccggcatcg acttgctgat cgcttcagcg       300
     cgccagaaag aagaggttgc cacctacaag cgcttgttgc agggacgccg tgtcgatggg       360
     ttcatcgtcc accacacgcg ccgtgtcgat ccccggcttg actacctcca ggaatgcggt       420
     gcgccgttcg tggcctatgg ccgcacagac acgcctgact cgtatgcttg gttcgacttc       480
     gataatgccc tcggtagctc tctggcggtc cggcgcttac aagaatttgg ccatcggcgg       540
     attgcctaca tgcacgcgcc tctggagctg cacttcgcct accaacgcta ccagggctac       600
     ctggatgcca tgcatgccgc gggcttgccc gtggatccag gtcttgtcgt tccggcgggg       660
     ttcgggcgtc gcggtggtta cgaggcgatg aagacgctgc tcgaccgcgc cgaaggtccg       720
     accgcagtga tcgttgacaa taatttgtgt ggtgtgggtg tcctgcgctg cgcattggac       780
     gcgggcctga agatcgggcg ccagctttcc ctcatcgttt acgacggcgt accggttgat       840
     tccgtcgtaa cctcggtgca ggtcacgtcg attgagcagc ccacgtcgta tgccgtgggc       900
     gtccagctcg cagaattgat gattggggtt ctcgccggcc agcctgtgca ggaattgcag       960
     acgctgtggt ctcctcgaat cgccgctggc tcgtcggacg gaccgatcag cgagcattga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page