(data stored in ACNUC7421 zone)

EMBL: CP000529.PE224

CP000529.PE224       Location/Qualifiers
FT   CDS_pept        231975..233042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0226"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: ccr:CC1137
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35551"
FT                   /db_xref="GOA:A1VIS3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS3"
FT                   /protein_id="ABM35551.1"
FT                   /translation="MKRTQKTSSRSADDATEKGRPQMADLARLAGVSVATVSRALNGSA
FT                   LISKDTRERIEELARSLNYSINIGAKNLRLKQNRTIAVVIPYDRVSRQHISDPFFLAMV
FT                   GSLADAITERGFDMLLSRVDAESLDSAADLYNSGKAIGIILIGQWRHHDQLNQMAAKRM
FT                   PIVVWGTQIPQQLYCTVGGDNMAGGAMATRHLLERGYRRIVFIGDPQLAEVTYRHQGYV
FT                   EALAAYGLQPDPQLLVCVPFDANEARAGINRLCEQGVSFDAVFACSDVMASAASQVLHL
FT                   HGRTVPDAVGVVGYDDIEWASHCNPPLTTVRQPIGAAGAELVDALLCVIDGVVVVPRVL
FT                   PVELVVRSSTRPDPG"
     atgaaaagaa cccagaagac gtcttcacgg tccgcagatg acgccacgga gaaggggcgc        60
     ccgcaaatgg ccgaccttgc gcggctggca ggcgtttccg tggccacggt atcgcgcgca       120
     cttaatggca gcgcgctgat cagcaaggac acccgtgagc gaattgaaga gcttgcgcgt       180
     tcgctcaact attccatcaa tatcggcgcc aagaatctgc ggctcaagca gaaccgcacg       240
     attgcggttg tgattccgta tgaccgggtg tcacgccagc atatttcgga tccttttttc       300
     ctggccatgg tgggcagcct ggctgatgcc attaccgagc gcgggtttga catgctgctg       360
     tcgcgcgtgg atgctgaaag cctggattcc gccgcagacc tgtacaactc ggggaaggcc       420
     atcggtatca tcttgatcgg gcagtggcgg caccatgacc aactaaacca gatggctgca       480
     aagcgcatgc cgatcgtggt gtggggcacc cagattcctc agcagctcta ttgcacggtg       540
     ggcggcgaca acatggccgg cggtgccatg gcgacgcggc acctgcttga gcggggatac       600
     cgccgcattg tgttcattgg cgacccgcaa ctggccgagg tgacctaccg ccaccagggc       660
     tatgtcgagg cgcttgcggc gtatggcctg cagccagatc cgcaattgct ggtgtgcgtg       720
     ccttttgatg ccaatgaagc acgagcgggt atcaaccggc tgtgcgagca gggggtgtct       780
     tttgacgccg tattcgcctg cagcgacgtc atggcttcgg cggcgagtca ggtacttcat       840
     ctgcacggcc ggacagtgcc ggacgcggtg ggtgtggtgg gttatgacga catcgaatgg       900
     gccagccatt gcaacccccc cttgaccacg gtacgccagc ctatcggtgc ggccggtgct       960
     gagctggtgg atgcgctgct ctgcgttatc gatggggtgg tggtggttcc ccgggttctg      1020
     ccagtagagc tggtggtgcg gtccagcacg aggccggatc cgggttga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page