(data stored in ACNUC7421 zone)

EMBL: CP000529.PE225

CP000529.PE225       Location/Qualifiers
FT   CDS_pept        233340..234614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0227"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: atc:AGR_pAT_379 putative sugar transport sugar
FT                   binding protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35552"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS4"
FT                   /protein_id="ABM35552.1"
FT                   /translation="MKQKYSGFMAALTATLATAMPVQAQTMVTMWVHAGPGPEAVAYSA
FT                   ATDAFNAQNKDIKLDLVKLPEGSYSNQVSAAALARKLPCLLDFDGPNVYNYAWTKKIIP
FT                   LDTFPELVAVKADLLPSLLRQGTYGGKLYSLGQFDSGLGIWGNKKLLEKAGVRIPGSVL
FT                   EAWTLAEFEDALKKLKSSGVAAPLDMKFNYGVGEWFTYGFSPIVQSFGADLIDRKTFKS
FT                   SKGVINGDAAVKALTTLQGWVKAGYVNPATKDDGDFIKGKAALSYVGHWTFKDYKKALG
FT                   DDLVLIPMPAFGAKPVTGAGSWNFGISADCKDPKAAAKVLAHLMSTPEILRVTEANGAM
FT                   PGTNSALAQSRDYGVKGGLNIYVQQVRQGVALVRPETPAYPAISTAFAEALNNIVAGAD
FT                   VQKELDRASKKIDQNIEDNKGYPIK"
     atgaagcaga aatattcggg atttatggct gcgctgacag caacactcgc caccgccatg        60
     ccggtgcagg ctcagaccat ggtgacgatg tgggtgcatg ccgggccagg ccctgaggcg       120
     gttgcctact ccgcagcgac agatgccttc aacgcgcaga acaaggacat caagcttgac       180
     ctcgtgaagt tgcccgaagg cagctacagc aaccaggtga gtgctgctgc acttgcccgc       240
     aagctgccct gcctgttgga cttcgatggt cctaacgtct acaactacgc atggacgaag       300
     aagatcatcc cgctggacac ttttccggag ttggtcgcgg taaaagcaga cctgcttcca       360
     tcgctgcttc gccagggaac ttacggcgga aaactctaca gcttgggcca gtttgactca       420
     ggtctgggaa tctggggcaa caaaaagctg ctcgaaaagg cgggggtgcg tatccctggc       480
     tctgtgctcg aggcgtggac gctcgccgag ttcgaggacg cgctgaagaa gctcaaaagc       540
     agcggtgtgg ccgctccgtt ggacatgaag ttcaactatg gcgtcggaga gtggttcacc       600
     tatggtttct cgccaatcgt gcagagcttt ggcgcagacc tgatcgaccg caagacattt       660
     aaatcctcca agggagtgat caatggcgat gccgcggtga aagcgctgac cacgctgcag       720
     ggctgggtca aggcgggtta cgtgaatcct gccaccaagg atgacggcga ctttatcaag       780
     ggcaaggcgg cgctgtccta tgtgggccac tggaccttca aggactacaa gaaggcgctc       840
     ggtgatgatc tggtgctgat tcccatgccg gccttcggcg ccaagccggt gactggcgct       900
     ggctcatgga acttcggcat ctcggccgac tgcaaggatc cgaaggcggc agccaaggtg       960
     ctggcccatc tgatgtcaac cccggagatc ctgcgcgtga ccgaggcaaa tggtgcaatg      1020
     cctggaacca attcagcgct ggcccagagc agggactacg gtgtcaaggg cggcttgaac      1080
     atttatgtac agcaggttcg ccagggagtg gcgctggtac gccctgaaac gccggcttat      1140
     ccggccatca gcacggcctt tgccgaggcg ttaaacaaca ttgtggcggg cgctgacgtc      1200
     caaaaggagc tcgaccgcgc ctccaaaaag atcgaccaga acatagagga caacaagggt      1260
     tacccgatca agtga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page