(data stored in ACNUC7421 zone)

EMBL: CP000529.PE227

CP000529.PE227       Location/Qualifiers
FT   CDS_pept        235990..236928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0229"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PF00048 probable
FT                   sucrose ABC transporter, permease protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35554"
FT                   /db_xref="GOA:A1VIS6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS6"
FT                   /protein_id="ABM35554.1"
FT                   /translation="MTFIDRQVSVKPPRFTPYQLTPWFFAAPALVLLFVFLILPFALAF
FT                   VFSFTDQRLIGNDELGTSFVGVRNYTRLFEDDSFWAALRNNFFFVCVVAPLQSLSALGL
FT                   ALLVNQALAGTRFFRTIYFMPVATTMAVVAVVWSLLYSPDAGVINRLVGLLSFGAVGPQ
FT                   DWLRDPALVMPAVMVLSIWQGVGFQMLVFLAGLQSISGDLYEAAKLDGATPWKQFRYIT
FT                   LPMLKNTTIFVLVTTTIQAFQLFTQVQIIQASGASAPVDSFRTMVMLMVHEGFGNGKIG
FT                   YASGVSVVFFVIVLTVSLVQRIVLREERAVQ"
     atgactttta tcgacagaca agtttctgta aaaccaccac gattcacccc ttaccagctc        60
     actccctggt tcttcgcggc gccagccctg gtgctgttgt tcgtcttttt gatcctgcca       120
     ttcgcgctgg cgtttgtctt ttccttcacg gaccagcgat tgatcggcaa cgacgagctg       180
     ggaaccagct ttgtcggtgt ccgcaattac acgcgcctct tcgaagacga cagcttttgg       240
     gcggcgctga gaaataactt cttttttgtg tgcgtggtgg ccccattgca atccttgagc       300
     gcactgggcc tggcattgct ggtcaaccag gcgctggccg gcacgcggtt ctttcgcacc       360
     atctatttca tgccggtggc gaccacgatg gcggtggtcg ccgttgtgtg gtcactgctg       420
     tacagccctg atgcaggggt gatcaaccgt ctggtcggtc tgctcagctt tggcgcggta       480
     gggcctcaag actggctgcg cgacccggcg ttggtcatgc cggcggtgat ggtgctgtcc       540
     atctggcagg gcgtcggctt ccagatgctg gtcttcctgg cgggcttgca gtcgatttcg       600
     ggcgacctgt acgaggctgc caagctcgat ggcgccacgc catggaagca gtttcgctac       660
     atcacgctcc ccatgctgaa gaacaccacg attttcgtgc tggtgacaac gacgatccag       720
     gcatttcagc ttttcacgca ggtgcagatc attcaggcca gcggtgcatc agccccggtg       780
     gacagcttcc gaaccatggt gatgctgatg gtccacgaag gttttggcaa cggaaagatc       840
     ggctacgcat cgggggtctc ggtcgtgttc ttcgtaatcg ttttgaccgt gtcactggtg       900
     cagcgtatcg tgctgcgcga agaaagggct gtgcaatga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page