(data stored in ACNUC7421 zone)

EMBL: CP000529.PE228

CP000529.PE228       Location/Qualifiers
FT   CDS_pept        236925..237821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0230"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_pAT_376 sugar ABC
FT                   transporter, permease protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35555"
FT                   /db_xref="GOA:A1VIS7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS7"
FT                   /protein_id="ABM35555.1"
FT                   /translation="MNTTRNPSQKRGAFLAKVAQYALHALLVAFFLLPLVFMFVSAFKG
FT                   DELQLLGDMGSLMAFVPHGDLSLQNFHDVFDRSPFKLAFFNSVLTVSLTVALGLIVNSM
FT                   LAYALARFQFRGRDTLLAMVVALIIIPFEAVAVPLLLLVNELPWFNGHSVVTGWLDSYH
FT                   VQVIPFIANAFSVYLFYQFFIALPKDLEEAALMDGASRWRIYWSIVMPLSKPVIATVTV
FT                   LQFLARWGDLLWPVMVVRGDTFATLPLAMQTFFGQFPRQWGDVMAFAAMATLPTLLLFI
FT                   VFQRWFVKSAISSGIKG"
     atgaatacca cccgcaatcc ctcgcaaaag cgcggtgcct tcctggccaa ggtggcgcaa        60
     tacgccctgc atgcgctgct cgtagctttc tttttgctgc cgctggtctt catgtttgtt       120
     tccgccttca agggcgatga gcttcaactg cttggtgaca tgggcagcct gatggctttc       180
     gttccccatg gagatctctc gttgcagaac ttccatgatg tgttcgaccg ctcgcccttc       240
     aagctggcct tcttcaattc ggtgctcact gtcagtttga cggttgcgct ggggttgatt       300
     gtgaacagca tgctggccta tgcgcttgcg cgctttcaat ttcgcgggcg cgacaccctg       360
     ctcgccatgg tggtggcgct catcatcatt ccctttgagg cagttgccgt gcccctgctg       420
     ctgctggtaa acgaactccc ctggttcaac ggccatagcg tggtgacagg gtggctcgat       480
     agctaccacg tacaggtgat tccgtttatc gcgaatgcgt tctccgttta cctcttctac       540
     cagttcttca ttgcgctacc aaaggatctg gaggaggccg cgctgatgga cggggcttcg       600
     aggtggcgga tttactggag cattgtgatg cccttgtcca agccggtgat cgccaccgtc       660
     acggtgttgc agttccttgc tcgctggggt gacctgctgt ggccggtgat ggtggtgcgc       720
     ggtgacactt tcgcgacctt gccattggcc atgcagactt tctttggcca atttcctcgc       780
     caatggggcg atgtgatggc attcgccgcg atggccacgc tgccgacctt gctgctgttc       840
     atcgtattcc agcgctggtt cgtgaaaagt gcgatttcca gcggtatcaa aggttaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page