(data stored in ACNUC7421 zone)

EMBL: CP000529.PE230

CP000529.PE230       Location/Qualifiers
FT   CDS_pept        238956..240437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0232"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: atc:AGR_pTi_251
FT                   sucrose phosphorylase SplA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35557"
FT                   /db_xref="GOA:A1VIS9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS9"
FT                   /protein_id="ABM35557.1"
FT                   /translation="MKNEVQLITYADRLSGGTLQDLRALLNGPLAGVFGAVHILPFFYS
FT                   IHGADAGFDPIDHTRVDPALGDWSDIKALAQDMDVMADVIVNHMSSDSPQFIDYSKRGA
FT                   ASPYNGLFLTFDAVFPEGATEEDLISVYRPRPGLPFTCMTLANGEKKILWTTFTPKQLD
FT                   IDVQHPQGRSYLESILQALASSGVKMIRLDAVGYAIKKQGDSCFLMPETFDFIDEFAAL
FT                   CRSVGLEVLVEVHSYYRKQIEIAKRVDWVYDFALPPLVLHAFFFKTGKHLKQWIAQRPT
FT                   NALTVLDTHDGIGIIDIGADPSDRVNRPGLVPPQELDRLVEIIHINSGGQSREATGAAA
FT                   SNLDLYQVNCTFYDAMGRDDTAYLLARAIQFFMPGIPQVYYVGLLAGRNDMDLLERTRV
FT                   GRDINRHRYASAEVDSALGRPVVQQLLELIRLRNAHPAFDGAFSVEPTGDSCLHMRWIN
FT                   GPVVAELLVDFTDLRHELLFTDEGGTRRIAFAKAF"
     atgaaaaacg aagtccaact catcacctat gccgaccgct tgagcggcgg aacccttcag        60
     gatctacgtg cgcttttgaa cggcccgctg gccggtgttt tcggcgctgt tcatatcctg       120
     ccgttcttct actcgatcca tggtgcggat gccgggttcg accccataga ccacacccgc       180
     gtggaccccg ccctgggcga ctggagcgac atcaaggccc tggcgcagga catggatgtg       240
     atggccgatg tgatcgtcaa ccacatgtcg tcagactccc cgcagttcat cgactattcg       300
     aaacgtggcg cggcgtcgcc ctacaacggt cttttcctga cttttgacgc tgttttccct       360
     gaaggcgcca ccgaggaaga tctgatatcc gtgtatcggc cgcgtccagg cttgcccttt       420
     acctgcatga cgctggccaa tggcgaaaaa aaaattctct ggacaacatt cacgcccaag       480
     caactggaca ttgatgtgca gcatccgcaa ggccgcagct atcttgagtc aatcttgcag       540
     gcactggctt ccagtggcgt gaagatgatc cggctggacg ctgtgggcta tgcgatcaag       600
     aagcagggcg acagctgctt cttgatgccc gagactttcg acttcatcga cgagttcgct       660
     gcactgtgcc gctcggtggg gcttgaggtt ctggtcgagg tgcattccta ctatcgcaaa       720
     cagatcgaga tcgccaaacg cgttgactgg gtgtacgact tcgctctgcc tccactggtg       780
     ctccacgcgt ttttcttcaa gacaggaaag cacctcaagc aatggattgc ccagcggccg       840
     accaacgcat tgacggtact cgacacacac gacgggatcg gcatcatcga tataggcgct       900
     gatccgtctg atcgcgtgaa cagacccggc ctggtaccgc cccaggaact cgaccggttg       960
     gtggaaatca tccacatcaa cagcggcggc cagagccgcg aagcaacggg cgcagctgcg      1020
     tccaatctcg acctttatca ggtcaattgc actttttatg acgcgatggg ccgcgatgac      1080
     acggcctacc tgttggctcg tgcgatccag ttcttcatgc cgggcattcc gcaggtctat      1140
     tacgtcggat tgctggcggg caggaatgac atggacttgc ttgagcgtac ccgcgtgggt      1200
     cgggatatca accggcaccg ttacgcgagc gctgaggtcg attcagcgct cgggcggcca      1260
     gtcgtacagc aactcctcga gttgatccgg ctacgtaatg cgcatcccgc gttcgacggc      1320
     gcgttcagtg tcgagccaac cggcgacagc tgcctgcaca tgcggtggat caacgggcct      1380
     gtggtggctg agctgctcgt cgatttcacc gaccttcgcc atgaactcct gttcacggat      1440
     gagggcggga cgaggcggat tgcttttgcc aaggcgtttt aa                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page