(data stored in ACNUC7421 zone)

EMBL: CP000529.PE232

CP000529.PE232       Location/Qualifiers
FT   CDS_pept        complement(241187..241393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0234"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   pol:Bpro_0507 protein of unknown function DUF1458"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35559"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT1"
FT                   /protein_id="ABM35559.1"
FT                   /translation="MNSHVYKQLELTGSSTVGIEDAVSTAIAKAHETVRNIQWFSITET
FT                   RGHVVDGKVAHWQVSLKIGFTLE"
     atgaatagcc atgtgtacaa gcagcttgag ttgaccggtt cctcaaccgt cggtattgaa        60
     gatgcggtaa gcaccgccat tgccaaggca catgagacgg tgcgcaacat ccagtggttc       120
     agcatcaccg agacccgcgg ccatgtggtc gatggcaagg tcgcgcactg gcaggtgtcc       180
     ctgaaaatcg gcttcacgct tgaataa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page